KEGG   Alkaliphilus metalliredigens: Amet_2949Help
Entry
Amet_2949         CDS       T00551                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
amt  Alkaliphilus metalliredigens
Pathway
amt00500  Starch and sucrose metabolism
amt01100  Metabolic pathways
amt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Amet_2949
Enzymes [BR:amt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Amet_2949
Exosome [BR:amt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Amet_2949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Glyco_hydro_70 AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: ABR49099
UniProt: A6TSD1
Position
complement(2973933..2975828)
Genome map
AA seq 631 aa AA seqDB search
MGKKMISQQDVYLFHEGTNYYGYKSLGAHVTVEGGQKGTRFTAWVPNAKEVRVAGDFNHW
QGQQHPMEKIPDSKLWSVFIGGIQEGTLYKYEILGDNGAFYLKIDPYGFLSEPRPNTASI
VCELEDYPWQDQKWQQNKVVENSLHRPVMIYEVHLGSWRRKADDSFCNYREIAHELGDYA
VEMGYTHVEVMPIMEHPLDDSWGYQITGYYAVTSRYGNPKDFMYFVDYLHQKGIGVILDW
VPGHFCADAHGLRQFDGGNVYEYQDANRAINKEWGTVNFDLGKPEVKSFLISNACFWMEM
YHIDGLRVDAVANMLYLDYGREHGDWTANQYGGNENLEAVDFLKQLNKAVFQYFPNHFMI
AEESTQWPMVTAPIHVGGLGFNYKWNMGWMNDTLKYMELDPIHRKWSHNLLTFSLMYTYT
ENFILPLSHDEVVHEKKSLLEKMSGNYWEKFANLRCYYGYLMAHPGKKLLFMGGEFGQFI
EWNHNKALDWMLLDHEMHRKLHQYMKDLIHFYKEEASLWQNDYQVEGFQWIDPNDYQQSM
ITFMRRRADDFTIIICNFTTIPREQYRVGVPFKGNYKEVFNSDSTEYGGSGVKNPRVMKA
EKVKWHNQSYSIETSIPPLGVLYIRQEKDEE
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaaaaatgatttctcagcaggatgtatatttattccatgaaggaactaattat
tatggttacaagagtttaggagcacatgtgacagtggaaggcggacaaaaaggaacacgg
tttaccgcatgggtaccgaatgccaaggaagtcagagtagcaggagattttaaccattgg
cagggacagcagcatcccatggaaaaaattccggattctaaactttggtctgttttcata
ggagggatacaagaaggtacactctataaatatgagattttaggtgacaatggagcgttc
tatttgaaaattgatccctatgggtttttatcggagcctcgacccaacacagcttctatt
gtatgtgaactagaagactatccatggcaggatcagaaatggcagcaaaacaaagtagta
gaaaactctttacataggcctgttatgatttatgaggttcatttaggctcatggagaaga
aaggcagatgatagtttttgtaactacagggaaatagcccatgaactaggggattatgca
gtggaaatggggtatacccatgtggaagtgatgccgattatggaacatcccctagatgat
tcatggggatatcaaattacaggctattatgctgtcacaagtagatatggaaaccccaag
gactttatgtattttgttgattatcttcaccaaaagggaattggggtcattttagattgg
gtgccaggccatttctgtgccgatgcccatggcctccgccaatttgatgggggaaatgtt
tatgaataccaggatgccaatcgagccattaacaaagagtggggaactgtcaactttgac
ttaggaaaacctgaggtcaagagctttctcatatccaacgcctgcttctggatggagatg
tatcatattgatgggttgcgggtggatgcagttgccaacatgctctatctagattacgga
agagaacatggggattggacggctaatcaatatggcggtaatgaaaacctagaggcagta
gactttttgaaacagttaaataaggcagtttttcagtactttcccaatcactttatgata
gcagaggaatctactcagtggccaatggtaaccgcacctatccatgtaggtggattaggg
tttaattataaatggaatatgggatggatgaacgacacgttaaagtatatggagttagat
cccatccataggaaatggtcccataacctgttaacattttccctaatgtacacctataca
gaaaatttcattttacccttatcccatgatgaagtggtccatgaaaaaaaatcactactg
gagaaaatgtccggtaactattgggaaaagttcgctaatctacgatgttattatggttat
ctcatggcacatccagggaagaaattacttttcatggggggcgaatttggacagtttatt
gaatggaatcataacaaagccctagattggatgttattggaccatgaaatgcacagaaag
ttgcatcagtacatgaaggaccttatccacttttacaaggaagaagcgtccctatggcaa
aatgactatcaagtggaaggatttcagtggattgatcccaatgattatcagcagagtatg
attacatttatgcgaagaagggcagatgattttacaattattatttgtaatttcactacg
ataccacgggagcaatatcgagttggcgtccccttcaaaggtaattataaagaagtgttt
aatagtgattccactgaatatggtggatcgggagtaaaaaaccctagggtaatgaaagct
gaaaaagtaaaatggcataaccagtcatattctattgaaacatctataccccctctaggg
gtgctttatataagacaagaaaaagacgaagagtag

DBGET integrated database retrieval system