KEGG   Alkaliphilus metalliredigens: Amet_4076Help
Entry
Amet_4076         CDS       T00551                                 

Definition
(GenBank) deoxynucleoside kinase
  KO
K15519  deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
amt  Alkaliphilus metalliredigens
Pathway
amt00230  Purine metabolism
amt00240  Pyrimidine metabolism
amt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amt00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Amet_4076
   00240 Pyrimidine metabolism
    Amet_4076
Enzymes [BR:amt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     Amet_4076
    2.7.1.76  2'-deoxyadenosine kinase
     Amet_4076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dNK Thymidylate_kin TsaE AAA_18 AAA_22 ABC_tran AAA_33 PRK Tfb5 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ABR50158
UniProt: A6TVE0
Position
4170061..4170750
Genome map
AA seq 229 aa AA seqDB search
MLTKFMVHNDYVPQSKDDHEGRFITVAGNVGAGKSTFTRILGQSLQFNTSFEKVIGNPYL
EDFYRDQKRWSFHLQLYFLSQRFQDQKRIGQEKSHHIQDRSIYEDVEIFAKSLYENRKMS
QRDFDTYSELFYCMMTPYLIKPDLMIFLNGSIDTVLNRIDKRGRAMEKQVPKSYWMDLHR
RYEQWISEYKESPVLVVNIDEADLLARPDQVDLIKKEIQNILNVKNNYQ
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgttaacaaagtttatggtacataatgattatgtccctcaaagtaaagatgatcatgag
ggtcgttttattacagttgcaggcaatgtcggtgctggaaaatctacattcaccagaata
ttaggtcaatcgttacaatttaatacaagcttcgagaaagtgattggaaatccctatttg
gaagatttctatcgagatcaaaagagatggagtttccatttacagctctactttttaagc
caacgctttcaagatcaaaaacgcattggtcaagaaaagtctcatcacattcaagataga
agcatctatgaagatgttgagatctttgctaaatctttatatgaaaataggaaaatgtca
caaagagactttgatacttattcagaattattctactgtatgatgaccccttatttaatc
aaaccagatttgatgatttttctaaatggaagcatcgatacggttttaaatcggattgac
aaacgaggaagagctatggaaaagcaagttcccaaaagctattggatggatcttcataga
cgctatgagcaatggatcagtgagtacaaagagtctcctgttttagtggttaatattgat
gaggcagatctcttggcccgacctgatcaagtggatttgattaagaaggaaattcaaaat
attttaaatgtaaaaaataattatcaatag

DBGET integrated database retrieval system