KEGG   Alkaliphilus metalliredigens: Amet_4090Help
Entry
Amet_4090         CDS       T00551                                 

Definition
(GenBank) NUDIX hydrolase
Organism
amt  Alkaliphilus metalliredigens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-ProteinID: ABR50171
UniProt: A6TVF3
Position
complement(4182922..4183344)
Genome map
AA seq 140 aa AA seqDB search
MRQEISAGGVVVFGNAILLLKKYNGDWVLPKGKVENHESFQQAAVREVHEEAGVKVEVIQ
YINKIHYTFKNSWEDNDLINKTVHWFLMQSRTIACIPQKEEGFIDAKFIHMDRCIELAKY
DDEKQIIEKAIHLFRKTSQR
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
gtgcggcaagaaatcagtgccggcggtgtggtagtttttggtaatgctatactgctacta
aaaaaatataatggagattgggttttaccaaaggggaaggtggaaaatcacgaaagtttt
caacaggcagctgttcgtgaggtccatgaagaagcaggtgttaaggtggaagtgatacaa
tacattaataaaattcattataccttcaaaaatagttgggaagataatgatttgattaat
aaaactgtccattggttcttaatgcagtctaggacaatcgcttgtattccacaaaaagaa
gaaggctttattgatgctaaattcattcacatggatcgctgcatcgaattggcaaagtac
gatgatgaaaaacaaattattgaaaaagcaattcatctatttagaaagacctcacaaagg
tag

DBGET integrated database retrieval system