KEGG   Alkaliphilus metalliredigens: Amet_4121Help
Entry
Amet_4121         CDS       T00551                                 

Definition
(GenBank) putative glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
amt  Alkaliphilus metalliredigens
Pathway
amt00010  Glycolysis / Gluconeogenesis
amt00052  Galactose metabolism
amt00500  Starch and sucrose metabolism
amt00520  Amino sugar and nucleotide sugar metabolism
amt00521  Streptomycin biosynthesis
amt01100  Metabolic pathways
amt01110  Biosynthesis of secondary metabolites
amt01120  Microbial metabolism in diverse environments
amt01130  Biosynthesis of antibiotics
amt01200  Carbon metabolism
Module
amt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
amt_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:amt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Amet_4121
   00052 Galactose metabolism
    Amet_4121
   00500 Starch and sucrose metabolism
    Amet_4121
   00520 Amino sugar and nucleotide sugar metabolism
    Amet_4121
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Amet_4121
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Amet_4121
Enzymes [BR:amt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Amet_4121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Hydant_A_N AD
Motif
Other DBs
NCBI-ProteinID: ABR50202
UniProt: A6TVI4
Position
complement(4216945..4217895)
Genome map
AA seq 316 aa AA seqDB search
MKYIGIDLGGTSIKAGLVNEVGEILKRCSEPTPVKEGYRAVVQVMVEMIDQLIKQEGISK
EEINCIGVGIPGVCNKEGFVYYATNLFWENIPLAEALQEKTGLSVYVENDATVAAMGESV
KGALTGVKNAIFLTLGTGVGGGLVINNQVYSGNHGIGSELGHMVIGENFYDCNCGNNGCL
ETFASATALTKYTQKLIKEGKESMLIEKTQGEIEAITAKLIFECAYHGDAVSIQAIERLV
KYLSIGIANLINILAPEVIAIGGGVSQAGDYLLDKLNKTIPQYVWCNHVPHAKIVLAELK
NDAGIIGSAMFARARD
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacatcgggattgatttgggaggaacgtctattaaggcgggcttagtcaatgaa
gtaggagaaattttaaaacgttgcagtgaaccaactcccgtaaaggaaggctaccgggcg
gttgtgcaagtgatggtagagatgattgaccaattgattaaacaagaaggaatttctaag
gaagagattaactgtataggagtcggcattcccggtgtatgtaacaaagaaggcttcgtc
tattatgccactaatttgttttgggaaaatattcctctagcagaggctctacaagaaaag
acgggtctttctgtttatgtggaaaatgatgcaacggtggcagccatgggagaatcagtg
aagggcgcattaactggggtaaagaatgcaatatttttgacattaggaactggtgttggc
ggtggcttggtgattaataaccaagtgtacagtggtaatcatggaatcggtagtgaacta
ggacatatggtgataggtgaaaacttttatgattgtaattgtggaaataatggatgctta
gaaacatttgcttcggccactgccttaactaaatatacgcaaaaactaattaaagaaggt
aaagaaagcatgctaatagagaaaacacaaggggagattgaagcaataacggctaaactg
atttttgaatgtgcttaccatggtgatgctgtatccatacaagcaattgagcgactcgtt
aaatacttgtccattggaattgctaatttgattaatatactagcacctgaagtcattgca
attggtggcggggtatcacaagcaggagattatttattagataagctcaataaaaccatt
ccccagtatgtttggtgcaatcatgtacctcatgctaagattgtactggcagagttgaaa
aatgatgctggaataattggtagtgctatgtttgcaagagcaagagactga

DBGET integrated database retrieval system