KEGG   Alkaliphilus metalliredigens: Amet_4266Help
Entry
Amet_4266         CDS       T00551                                 

Definition
(GenBank) transcriptional coactivator/pterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
amt  Alkaliphilus metalliredigens
Pathway
amt00790  Folate biosynthesis
amt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Amet_4266
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amt04147]
    Amet_4266
Enzymes [BR:amt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     Amet_4266
Exosome [BR:amt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Amet_4266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ABR50344
UniProt: A6TVX6
Position
complement(4375388..4375723)
Genome map
AA seq 111 aa AA seqDB search
MNNLAEKKCIPCSLGTPPLSSDEIKRYISQLHEEWKVINDHHLEREFKFKNFKEALSYTN
VIGQLAEKEGHHPDMLLSWGKVKITLFTHKIDGLSESDFVFAAKVDKQQSE
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatttagcagaaaaaaaatgtataccttgtagtcttggaacaccccctttatca
tctgatgaaataaaaagatatatcagccaattgcatgaggaatggaaagtgatcaatgat
caccaccttgaaagggaatttaagtttaaaaactttaaagaggctttaagttataccaat
gttattggccaattagcagaaaaagaaggccatcatccagatatgcttttatcttgggga
aaggttaaaattacattgtttacccataaaatagatggattaagtgagagtgactttgta
tttgctgccaaggtagataaacagcaaagtgaatga

DBGET integrated database retrieval system