KEGG   Alkaliphilus metalliredigens: Amet_4335Help
Entry
Amet_4335         CDS       T00551                                 

Definition
(GenBank) NADH:flavin oxidoreductase/NADH oxidase
  KO
K00354  NADPH2 dehydrogenase [EC:1.6.99.1]
Organism
amt  Alkaliphilus metalliredigens
Brite
KEGG Orthology (KO) [BR:amt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Amet_4335
Enzymes [BR:amt01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.1  NADPH dehydrogenase
     Amet_4335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_FMN G3P_antiterm Dus
Motif
Other DBs
NCBI-ProteinID: ABR50409
UniProt: A6TW41
Position
4470784..4471806
Genome map
AA seq 340 aa AA seqDB search
MSALFSPFTLKDLTLKNRIVMAPMCQYSASETGYANQWHQVHYVSRAVGGVGLILLEATA
VEPRGRISQKDLGIWENGHVTGLKSIVTACKQYGARVGIQLAHAGRKCHIPSEKIVAPSA
IAFNEEYATPTSLSQNEIQTIVQAFIHGAARALEAGFDVIEVHGAHGYLINEFLSPLTNH
REDQYGGSPENRVRFLKEVLEGIQGVWPKNLPIILRVSAEDYIKEGNHPEDLAEMINLVK
EYGIDMVNVSSGAVVPAKIKPYPGYQIPFSETIKKQTNLPTIAGGLITTATMAEEVLRNE
RADLVYLGRELLRNPYWPLHSAKEVRDDILWPLQYEMSKV
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
ttgtctgcattatttagtccctttacactcaaggatttaacattaaaaaatcgaattgtg
atggcaccgatgtgtcaatacagcgcaagtgaaacaggatatgccaatcaatggcatcag
gtgcattatgttagtcgtgctgttggtggtgtggggttaatcttacttgaagcaactgct
gtagaaccgagaggtcgtatttcacaaaaggaccttggtatctgggaaaatggacatgtg
acaggtttgaaatccattgtcaccgcctgcaaacaatatggtgcacgggtaggtattcag
ttagcccacgcaggtagaaagtgtcatatcccttcagaaaaaattgttgctcctagtgcc
attgcctttaacgaagaatatgcaacacctacatcattatctcaaaatgaaattcagacc
attgttcaagcctttattcatggagctgcccgggctttagaagctggattcgacgtcatt
gaagttcatggcgcccatggttacttaattaatgaatttttatcccccctgaccaatcat
cgagaggatcaatatggcggaagtcctgaaaaccgtgtgcgatttcttaaggaagtttta
gagggtattcaaggagtttggcctaaaaatttacccatcattcttcgggtttctgcagaa
gactacataaaagagggtaaccatccagaagatttagctgaaatgattaatcttgttaag
gaatatggtattgatatggttaacgttagctctggtgccgttgtgcctgctaaaatcaag
ccttacccaggctatcaaatcccgttctccgaaaccattaaaaaacaaactaacttgccc
actattgcgggaggattgattacaacagctaccatggctgaagaagttttgcgcaatgaa
cgggcagacttggtttatttaggcagagagttgctacgcaatccctattggccattacat
tcagctaaagaggttcgggacgatattttatggcctcttcaatatgaaatgagtaaagta
tag

DBGET integrated database retrieval system