KEGG   Alkaliphilus metalliredigens: Amet_4473Help
Entry
Amet_4473         CDS       T00551                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
amt  Alkaliphilus metalliredigens
Pathway
amt03010  Ribosome
Brite
KEGG Orthology (KO) [BR:amt00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Amet_4473
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:amt03011]
    Amet_4473
Ribosome [BR:amt03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Amet_4473
  Bacteria
    Amet_4473
  Archaea
    Amet_4473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ABR50545
UniProt: A6TWH7
Position
complement(4574696..4575028)
Genome map
AA seq 110 aa AA seqDB search
MEARAIAKFVRIAPRKVKIVVDLVRGKQVDEALAILKHTPKGASPVVIKLIQSAVANAEN
NHEMDREQLFVSEVYANQGPTMKRFRPRAMGRATTIRKRTSHIGIVVKEK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
gtggaagcaagagcaattgcaaagtttgtgagaatcgcacctagaaaagttaaaatcgtt
gtagaccttgtaagaggaaagcaagtagatgaggctttagcgattttaaagcatacgcca
aagggagcatcaccagttgtgattaaactaatccagtcagcagtagcaaacgctgaaaat
aatcatgaaatggatagagagcaattattcgtttctgaggtttatgcaaaccaaggacca
acaatgaaaagatttagaccaagagccatgggtcgtgcaacaactataagaaaaagaaca
agtcatatcggaattgtcgtaaaagaaaaatag

DBGET integrated database retrieval system