KEGG   Alkaliphilus metalliredigens: Amet_4630Help
Entry
Amet_4630         CDS       T00551                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
amt  Alkaliphilus metalliredigens
Pathway
amt00071  Fatty acid degradation
amt00280  Valine, leucine and isoleucine degradation
amt00310  Lysine degradation
amt00362  Benzoate degradation
amt00380  Tryptophan metabolism
amt00620  Pyruvate metabolism
amt00630  Glyoxylate and dicarboxylate metabolism
amt00640  Propanoate metabolism
amt00650  Butanoate metabolism
amt00720  Carbon fixation pathways in prokaryotes
amt00900  Terpenoid backbone biosynthesis
amt01100  Metabolic pathways
amt01110  Biosynthesis of secondary metabolites
amt01120  Microbial metabolism in diverse environments
amt01130  Biosynthesis of antibiotics
amt01200  Carbon metabolism
amt01212  Fatty acid metabolism
amt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:amt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Amet_4630
   00630 Glyoxylate and dicarboxylate metabolism
    Amet_4630
   00640 Propanoate metabolism
    Amet_4630
   00650 Butanoate metabolism
    Amet_4630
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Amet_4630
  Lipid metabolism
   00071 Fatty acid degradation
    Amet_4630
   00072 Synthesis and degradation of ketone bodies
    Amet_4630
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Amet_4630
   00310 Lysine degradation
    Amet_4630
   00380 Tryptophan metabolism
    Amet_4630
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Amet_4630
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Amet_4630
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Amet_4630
Enzymes [BR:amt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Amet_4630
Exosome [BR:amt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Amet_4630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt 7TMR-HDED
Motif
Other DBs
NCBI-ProteinID: ABR50701
UniProt: A6TWY3
Position
complement(4746120..4747298)
Genome map
AA seq 392 aa AA seqDB search
MREVVIVSAARTPIGSFGGALKDVNVADLGAGAIKGALERAGIKGDMVEEVFMGCIIQAG
NKQNVARQAAAKAGIPFEVTSMTINMLCGSGLRAVSLGAQTILAGDNDIVVVGGAESMSQ
APYVLPNMRWGSKLGDVKALDTLLTDALSCAFNDYHMGITAENLAEKYNITREEQDAFAV
SSQNKAEKAQNEGGFDAEIVPVVIKTRKGEVIVDKDEYIKHGATAEGLAKLRAAFKKEGT
VTAGNASGINDGAAALVLMSAEKAKELGIKPLAKLVAYASGGVDPSVMGYGPVPATEKVF
EKSGWKVEDLDLIEANEAFAAQALAVAKGLNFNTDIVNVKGGAIALGHPVGASGARILTT
LLYAMEERDAKKGLATLCIGGGMGTSVLVERA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagttgttattgtcagtgcagctagaacgccgattggcagttttggtggagcg
cttaaggacgttaatgtggctgatttaggggctggagcgattaaaggagccctcgaacgt
gcagggattaaaggcgatatggtagaagaagtgtttatgggttgtattattcaggcggga
aacaagcaaaatgttgcaagacaagctgcagcaaaggctgggatcccatttgaagtgacg
tctatgacaatcaacatgctgtgtggatctggattaagagcagtatccttaggagctcaa
acaattcttgcaggagataatgacattgttgtagtaggtggagctgaaagcatgtctcaa
gccccatatgtacttcctaatatgcgttggggatcaaaactaggggatgtcaaagcatta
gatacattactgacagatgcattaagctgtgcattcaatgattatcatatgggaattaca
gctgagaatttagctgagaaatacaacattactagagaagaacaagatgcttttgctgtt
tcaagtcaaaacaaagcagaaaaagcacaaaacgaaggcggatttgacgcagaaatcgtg
ccagtagtcattaagacaagaaaaggcgaagtgatagtagataaagatgaatacatcaag
catggtgcaactgctgaaggattagcgaagctaagagcagccttcaaaaaagagggtaca
gtaactgcaggaaatgcatctggaatcaatgatggcgctgctgcattggtattgatgagt
gcggagaaggccaaagaactaggaatcaagcctcttgcaaaattagtcgcctatgcatct
ggtggagtagacccatctgtaatgggttatggtccagtgccggctactgaaaaggtattt
gaaaaatcaggatggaaagtagaagatcttgatttaattgaagcaaatgaagcatttgca
gcacaggctttagccgttgctaaaggattaaactttaacactgatattgtcaatgtaaag
ggtggagccattgccctaggacatccagtaggagcaagtggagctaggattctaacaaca
ttactttatgccatggaagaaagagatgccaagaagggcttagctacattatgcatcggt
ggcggaatgggaacttctgtattagtagagcgagcttaa

DBGET integrated database retrieval system