KEGG   Akkermansia muciniphila: Amuc_0885Help
Entry
Amuc_0885         CDS       T00736                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
amu  Akkermansia muciniphila
Pathway
amu00010  Glycolysis / Gluconeogenesis
amu00020  Citrate cycle (TCA cycle)
amu00620  Pyruvate metabolism
amu01100  Metabolic pathways
amu01110  Biosynthesis of secondary metabolites
amu01120  Microbial metabolism in diverse environments
amu01130  Biosynthesis of antibiotics
amu01200  Carbon metabolism
Module
amu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:amu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Amuc_0885
   00020 Citrate cycle (TCA cycle)
    Amuc_0885
   00620 Pyruvate metabolism
    Amuc_0885
Enzymes [BR:amu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Amuc_0885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: ACD04718
UniProt: B2UQI3
Position
complement(1053894..1055168)
Genome map
AA seq 424 aa AA seqDB search
MPKVPILMPQLGDSIAEATVLRLLAAQGDTVEADQEIFEVETNKATMGVTTMCGGILSDV
FIKEGESVVVGACMAMIEATEEEIERSGATPAGDSTQPSLPASPESVPQAAPSAPPREEK
PAGVHFGVTGESYQENGTDLKVQPSVRGLPVPAGMKGAHYMSPRMKARMDELGMSASDIA
FISGSGAGGRVTIDDLEEFLEYVSQWPHRKASSMRLAVADAMRRSWTRPLASAGRPVFMD
PLIKHRQNSPLRPGITLYFARALALSLAESPECAGYLVGENILSPKTIDIGIAAQVADGV
MVPVLRRVNERTMEELLEDYNRLIAQARRRRLAPEDSTGGIATVTNFGGFGLTFAAPMPM
PSESIILGVGAVTKTPVWSDEVEAFIPISKANIVATGDHRVVDGADIGRLLKRVAELLQR
PEYL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaagtacccattctgatgccccagctcggggattccattgcggaagccactgtg
ctgcgcctgctggcggcccagggcgataccgtagaagccgaccaggaaatctttgaggta
gaaaccaacaaggccaccatgggagtcaccaccatgtgcggcggcatcctgagcgatgtg
ttcatcaaggaaggggaatccgtcgtggtcggcgcctgcatggccatgattgaggccacg
gaagaggaaattgagcgttccggagcgactccggccggagattccacccagccgtccctt
ccagccagtccggaatccgttccccaggccgcgccctccgcccctccccgggaggaaaaa
cccgcaggcgtccacttcggggtgacgggggaatcctatcaggaaaacggaacggacctg
aaagtccagcccagcgtgcgcggcctccccgtacccgccggcatgaagggcgcgcactac
atgtccccccggatgaaggcgcgcatggatgaattgggcatgagcgcctccgacatcgct
ttcatctccggttccggggcgggcggacgcgtcaccattgacgacctggaagaattcctg
gaatatgttagccaatggccgcaccgcaaggcctcatccatgcggctggccgtggcggac
gccatgcgccgcagctggacgcgcccgctggcctccgccgggcgtcccgtattcatggac
cccctcatcaaacacaggcaaaattccccgctgcggcccggcatcaccctgtactttgcc
cgcgccctggccctgtccctggcggaaagcccggaatgcgccggctacctggtgggggaa
aacattctttctcccaaaacaatcgacatcggcatcgccgcccaggtggcggacggcgtc
atggttcccgtgctgcgccgcgtgaacgaacggacgatggaagaactgctggaagactat
aacaggctgattgcccaggcgcgccgccgcaggctggctccggaagacagcacgggcggc
atcgccacggtcaccaacttcggcggcttcggcctcacctttgccgcgcccatgcccatg
cccagcgaatccattatcctgggggtgggggccgtcaccaaaaccccggtctggagtgac
gaagtggaggcgtttatccccatctccaaggccaacatcgtggctacgggagaccaccgc
gtggtggacggagcggacatcggccgcctgctcaagcgcgtggcggaattgctccagcgc
ccggaatacctgtaa

DBGET integrated database retrieval system