KEGG   Akkermansia muciniphila: Amuc_1261Help
Entry
Amuc_1261         CDS       T00736                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
amu  Akkermansia muciniphila
Pathway
amu00010  Glycolysis / Gluconeogenesis
amu01100  Metabolic pathways
amu01110  Biosynthesis of secondary metabolites
amu01120  Microbial metabolism in diverse environments
amu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:amu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Amuc_1261
Enzymes [BR:amu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Amuc_1261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ACD05086
UniProt: B2URK1
Position
complement(1522293..1523147)
Genome map
AA seq 284 aa AA seqDB search
MTVRRTTNQGLSFLDVTTPLCTASLCLQGAHLTSWKPAGHEECLFLSPNAAFVPGKAIRG
GIPVCWPWFGPREGAPSHGIARTSEWRLHHQEMDKCGNVLLSLAFYPEDESYPAAILRLT
LGRTLAMRLETTARTQPCKLTEAFHNYFAVGNLTKCRVHGLEDIPFREEAAQPMKHGERP
LTPLGCLDRVYNFPSCSGKTMLEDLMLNRAITVERNHASSVIVWNPGQQGAKNMADLGAE
SWNKFLCIETGNAEPRSISLAPGQTHTLYQKISVRHMEEACSPR
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtccggcgcacaacaaaccaggggctttctttcctggacgtaacaacaccgctc
tgcacggcatccctgtgccttcagggagcgcacctcacctcatggaagccggcagggcat
gaggaatgcctttttctttctcctaacgcagcctttgtccccggcaaagccatccgcgga
ggcatccccgtctgctggccctggttcggcccccgggaaggagcaccgtcccacggcata
gcgcgcacctcggaatggcgcctccaccaccaggaaatggacaagtgcggcaacgtcctg
ctctccctggctttctatccggaagatgaatcctatcccgccgccatcctgcgccttacc
ctgggccgcacgctggccatgaggctggaaaccacggcgcgcacgcagccctgcaagctc
acggaagcattccataactactttgccgtcggcaacctgaccaaatgccgcgttcatggg
ctggaggacatcccgttccgggaagaagccgcccagcccatgaagcacggagaacgcccg
ctgacgccgctggggtgcttggaccgcgtttacaacttcccctcctgttcgggaaaaaca
atgctggaagacctcatgctgaaccgcgccatcacggtggagcggaaccatgcctcttcc
gtcatcgtctggaatcctggacaacagggcgccaaaaacatggcggacctgggtgcggag
tcctggaataaattcctgtgcattgaaacgggaaacgcggagccccgttccatttccctc
gctcccggacaaacccataccctttaccaaaaaatttccgtaaggcatatggaggaagcc
tgctctccccgttaa

DBGET integrated database retrieval system