KEGG   Akkermansia muciniphila: Amuc_1535Help
Entry
Amuc_1535         CDS       T00736                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
amu  Akkermansia muciniphila
Pathway
amu00260  Glycine, serine and threonine metabolism
amu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
amu01100  Metabolic pathways
amu01110  Biosynthesis of secondary metabolites
amu01130  Biosynthesis of antibiotics
amu01230  Biosynthesis of amino acids
Module
amu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:amu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Amuc_1535
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Amuc_1535
Enzymes [BR:amu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Amuc_1535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: ACD05356
UniProt: B2ULG9
Position
1837301..1838473
Genome map
AA seq 390 aa AA seqDB search
MKKEGYFGNFGGRFVPEALRPPLMELEEAMDSIMPSSEYRDALQDLLVNYAGRETPLTFC
PHLSEKLGFRLWLKREDLLHTGAHKINNALGQALLAKMMGKTHLIAETGAGQHGVATATA
AARLKMDCTIFMGAEDVERQSMNVMRMKLLGATVFPIESGSRTLKDAINEALRYWISHQA
DTLYCFGTAAGPHPFPTLVRQLQSVIGREARAQMLERAGRLPDVVVACVGGGSNAIGMLH
PFVEDEGVRLVGVEAGGTGEPGCYNSAPINLGSPGVLHGHVTMLLQDENGQIQPSHSISA
GLDYPGVGPEHAYLAETGRVHYGVICDASALNAFRTLTREEGIIPALESSHAVAWVLDHA
EELPQGGDVLVNLSGRGDKDLGIVKKYLNL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagaaggatatttcggcaatttcggcggccgcttcgtaccggaagcgctgcgc
cccccgctcatggagctggaggaagccatggactccatcatgccgtccagcgagtaccgg
gatgcgcttcaggatctgctggtcaattacgcgggccgtgaaactcccctcacgttctgt
ccccacctttcggaaaaactgggcttccgcctgtggctgaaacgggaggacctgctgcac
accggagcccacaaaatcaataacgccctcggccaggcccttctggccaaaatgatgggg
aaaacgcatcttattgcggaaaccggggcggggcagcacggcgtggctacggctacggcg
gccgcccggcttaaaatggactgcaccatctttatgggcgcagaggatgtagaacgccag
tccatgaacgttatgcgcatgaaattgctgggagcgacggtttttccgattgagagcggt
tcccgcacgttgaaggatgccattaacgaggctctccgctactggatttcccatcaggcg
gatactctgtattgtttcggtacggcggcgggcccccatccgttccccacattggtcagg
cagcttcaatccgtcattgggcgggaggcccgcgcccagatgctggagcgtgcaggcagg
ctgccggatgtggtggtggcatgcgtgggcggcggctccaatgccatcggcatgcttcac
ccctttgtggaggatgaaggcgtccgtctggtaggggttgaggcgggaggcaccggtgag
cccggctgttataactccgcccccatcaatctgggcagccccggcgtgctgcacggtcat
gtgaccatgctgttacaggatgagaacgggcaaatacagccgtcccattccatttccgcc
gggctggactatcccggggtaggcccggaacatgcctatctggcggaaacgggccgtgtc
cattacggtgtgatttgcgacgcctctgctttaaacgctttccggacgctcaccagagag
gaaggaatcattcctgcgctggaatcctcccatgccgtggcctgggtgctggaccatgcg
gaggaactgccgcaggggggggacgtcctggtcaatctctccggccgcggagacaaggac
ctgggaatcgttaaaaaatatttgaatctttaa

DBGET integrated database retrieval system