KEGG   Akkermansia muciniphila: Amuc_1671Help
Entry
Amuc_1671         CDS       T00736                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
amu  Akkermansia muciniphila
Pathway
amu00010  Glycolysis / Gluconeogenesis
amu00030  Pentose phosphate pathway
amu00051  Fructose and mannose metabolism
amu00052  Galactose metabolism
amu00680  Methane metabolism
amu01100  Metabolic pathways
amu01110  Biosynthesis of secondary metabolites
amu01120  Microbial metabolism in diverse environments
amu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:amu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Amuc_1671
   00030 Pentose phosphate pathway
    Amuc_1671
   00051 Fructose and mannose metabolism
    Amuc_1671
   00052 Galactose metabolism
    Amuc_1671
  Energy metabolism
   00680 Methane metabolism
    Amuc_1671
Enzymes [BR:amu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Amuc_1671
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Amuc_1671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ACD05489
UniProt: B2UM45
Position
complement(2025088..2026332)
Genome map
AA seq 414 aa AA seqDB search
MNPLKGACIIGQSGGPTAVINASALGAIQSALQSEQVTRVLGAANGIEGVLKERLFDMAR
EDPGELELLKYTPASALGSCRYKMAAPSVDDTDYRRLLEIFRKYDVRYFFYNGGNDSMDT
CNKISKFMQQSGYECRVIGIPKTIDNDLHGTDHCPGFGSAAKFIATSCMEVHQDLRVYDK
GRVTIVEIMGRHAGWLAGSAALATYAGAGPDLVYLPEVPFRMEEFWQDVDRIYRQNGSCM
VAVSEGVQYADGRFVAESGDRDVFGHTQLGGLGAMLAESVKRQTGAKVRSIELSLLQRCA
SHVASKTDIDEAYMAGKAAVEAAVSGQTDKMVAFERITENGIYSCKTKLIGLEEVANVEK
LVPREWINARGNGVEQPFIDYVLPLIQGETAMQKECSLPRFAKLRKVPAKPEQR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaacccattgaaaggagcatgcatcatcggccagtccggcggccccaccgccgtcatc
aacgccagcgcactgggagccattcagtccgccctgcaaagcgaacaggtcacgcgcgtg
ctgggagccgccaacgggattgagggagtgctcaaagaacgcctgttcgatatggcccgg
gaagaccccggagaattggaattgctcaaatataccccagcatctgccctgggttcctgc
cgctacaagatggcagccccgtccgtggatgatacggattaccgccgtctgctggaaatt
ttcagaaaatacgacgtacgctactttttctacaacggaggcaacgattccatggatacc
tgtaacaagatatccaaattcatgcagcagtccggttacgaatgccgcgtcatcggaatt
cccaagaccattgacaatgaccttcacggcacggaccactgccccggcttcggctctgcc
gccaaatttatcgctacctcctgcatggaagttcaccaggacctccgcgtgtacgacaag
ggacgcgtcaccattgtggaaatcatgggccgccacgccggctggctggccggatccgca
gccctggccacgtatgcgggagcaggtccggacctggtttacctgccggaagttcccttc
cgcatggaggaattctggcaggatgtggaccggatttacaggcagaacggcagctgcatg
gtcgccgtctcggaaggcgtgcagtatgcagacggccgctttgttgcggaatccggagac
agggacgtcttcggccatacgcagctgggaggcctgggagccatgcttgcggaatccgtc
aagcgacaaaccggggccaaagtcagaagcattgaactctcactcctccagcgctgcgcc
tcccatgtagcctccaagacggatatcgatgaagcgtatatggcgggaaaagccgccgtg
gaagccgccgtttccggccagacggataaaatggtagcctttgaacgaatcacggagaac
ggcatttattcctgcaagactaaattgataggtctggaagaagtggccaatgtggaaaaa
cttgttccccgcgaatggatcaacgcccgcggcaatggcgtggaacagccgttcattgat
tacgttcttcccctgatccagggagaaacggccatgcaaaaggaatgttccctgccccgc
ttcgcgaaactcaggaaagtgccggcaaagccggaacagcggtag

DBGET integrated database retrieval system