KEGG   Acidiphilium multivorum: ACMV_02440Help
Entry
ACMV_02440        CDS       T01446                                 

Gene name
metF
Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
amv  Acidiphilium multivorum
Pathway
amv00670  One carbon pool by folate
amv01100  Metabolic pathways
amv01120  Microbial metabolism in diverse environments
amv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ACMV_02440 (metF)
Enzymes [BR:amv01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     ACMV_02440 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: BAJ79591
NITE: ACMV_02440
UniProt: F0J205
Position
complement(284860..285792)
Genome map
AA seq 310 aa AA seqDB search
MSHTPPRAVLERWLSGPRVDPLPTPALRAPAPAISFEFFPPKTETLEAQLWACIRRLEPL
APRFVSITYGAGGSTQERTHATVTRLVRETTLVPAAHLTCVGASRGEVDDVARRYWDAGV
RHIVALRGDPPGGTAYAPHPEGYAYAADLVAGLRRVADFEISVAAYPETHTQAPSPQADL
DNLKRKLDAGATRAISQVFFETGHFLDFLDRALAAGITAPIIPGIMPVSNFGQAKRISEM
AGTHVPAWMGEMFDGLDDDAETRKMVAASIAAEQVRTLQANGIDEFHFYTLNRADLTYAI
ARILGVKPAR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacaccccgccccgcgccgtcctggaacgctggctgtccggtccgcgcgtcgat
ccgctgccaacgcctgcgctgcgcgccccggccccggcgatctcgttcgaattctttccg
cccaagaccgaaacactggaagcccagctctgggcctgcattcgccggctcgaaccgctg
gcgccgcgcttcgtctcgatcacctacggcgccggcggctcgacccaggagcgcacccac
gccaccgtcacccgcctggtgcgggagaccacccttgttccggcagcgcacctgacctgc
gtcggcgcctcgcgcggcgaggtcgatgatgtcgcccgccgctactgggatgccggcgtg
cgccacatcgtcgccctgcgcggcgacccgccgggcggcaccgcctatgcgccgcatccc
gagggctacgcctatgcggccgatctcgtcgccgggctgcgccgcgtcgccgatttcgag
atctcggtcgccgcctatcccgaaacccacacccaggcaccaagcccgcaggccgatctc
gacaatctgaagcgcaagctcgatgccggggcgacgcgggcgatcagccaggtcttcttc
gagaccggccatttcctcgactttctcgaccgcgcgctggccgccggcatcaccgcgccg
atcatccccggcatcatgccggtctccaatttcgggcaggcgaagcggatcagcgagatg
gccggcacccatgtccccgcctggatgggcgagatgttcgacgggctggacgacgatgcc
gaaacccgcaagatggtcgccgcgagcatcgccgccgagcaggtccgcacgctgcaggcc
aacggtatcgacgagttccatttctacaccctcaaccgcgccgacctcacctacgccatc
gcgcgcatcctgggcgtgaagccggccaggtga

DBGET integrated database retrieval system