KEGG   Acidiphilium multivorum: ACMV_05580Help
Entry
ACMV_05580        CDS       T01446                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
amv  Acidiphilium multivorum
Pathway
amv00030  Pentose phosphate pathway
amv00480  Glutathione metabolism
amv01100  Metabolic pathways
amv01110  Biosynthesis of secondary metabolites
amv01120  Microbial metabolism in diverse environments
amv01130  Biosynthesis of antibiotics
amv01200  Carbon metabolism
Module
amv_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
amv_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:amv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ACMV_05580 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ACMV_05580 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amv04147]
    ACMV_05580 (zwf)
Enzymes [BR:amv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     ACMV_05580 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     ACMV_05580 (zwf)
Exosome [BR:amv04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ACMV_05580 (zwf)
  Exosomal proteins of colorectal cancer cells
   ACMV_05580 (zwf)
  Exosomal proteins of bladder cancer cells
   ACMV_05580 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: BAJ79905
NITE: ACMV_05580
UniProt: F0J3P9
Position
626182..627681
Genome map
AA seq 499 aa AA seqDB search
MNFSQPIIDPFDYVVFGGTGDLARRKLLPALYLRDLDGQLPETSRIVGSARTDMTGEGFR
ELVEASLREFIADKLDPEVLARFLARLHYVSVDAKAARGWPELATLLSDEPRQIRVFYLA
TAPELYGPIADNIHAHGLQTPETRIVLEKPIGHDLASARAINDRVGAVFEERNIFRIDHY
LGKETVQNLLVLRFANSLFEPVWNHNGIDHVQITVAETVGVEDRGGYYDHTGALRDMIQN
HLMQLLCLVAMEPPATFDREEVRDEKIKVLKSLAPISRDDIATKSVRGQYRAGAIKGGPV
KSYAEEKDIAPGSTTETFAALKVEVRNWRWAGVPFYLRTGKRMPEKVSEIVIQFKPVPYW
IFPTGSDHAMPNRLVIRVQPDEHIRLHLWTKEPGPGGLRLRNAPLNLSFAETFKNNHMPD
AYERLLMDVVRGNATLFMRRDEVEAAWEWTESILDAWKSAGDRPKLYTAGTWGPSEAVAM
IVRDGRTWFDEQAGYGAGD
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttcccagcccatcatcgacccgttcgactacgtggtgttcggcggcaccggc
gatctcgcgcgccgcaagcttctgcccgcgctttacctccgcgatctcgatggtcaactg
ccggaaacgtcccgcatcgtcggctctgcccgaaccgacatgacgggcgaggggtttcgc
gaactcgttgaggccagtctgcgcgaattcatcgccgacaagctcgaccccgaggttctt
gcccgcttcctcgcccggctgcactacgtctccgtcgacgccaaggccgcgcgcggctgg
cctgaacttgccactttgctcagcgacgaaccgcgccagatccgcgtcttctacctcgcc
accgctcccgagctttacggcccgatcgccgacaacatccacgcccacggcctgcaaacg
cctgaaacccgcatcgtgctggaaaagccgatcggccacgaccttgcctccgcccgcgcc
atcaacgatcgtgtcggcgcggtgttcgaggagcgcaacatcttccgcatcgatcattat
ctcggcaaggaaacggtgcagaacctcctggtcctgcgcttcgccaactcgctgttcgaa
ccggtctggaaccataacggcatagaccatgtgcagatcaccgtcgccgagaccgtcggc
gtcgaggatcgcggtggctattacgaccataccggcgcgctgcgcgacatgatccagaac
cacctgatgcagctgctctgcctcgtggcgatggagccgccagcaacgttcgaccgcgag
gaagtgcgcgacgagaagatcaaggtattgaaatccctcgctccgatttcccgtgacgat
atcgcaacaaaatccgtccgtggccagtaccgcgccggcgcgatcaaaggcggcccggtg
aaatcctatgccgaggaaaaggacatcgcccccggctccaccaccgaaaccttcgccgcc
ctcaaggtcgaggtccgcaactggcgctgggccggcgtgccgttctatctgcgcaccggc
aagcggatgcccgagaaggtctcggaaatcgtcatccagttcaagccggtgccctactgg
atcttccccaccggctcggatcacgcgatgccgaaccgcctcgtcatccgcgtgcagccg
gacgagcatatccgcctgcatctgtggacgaaggaaccgggccccggcggcctgcgcctg
cgcaacgccccgctcaacctgagctttgccgaaaccttcaagaacaaccacatgccggat
gcctacgagcgcctgctgatggatgtggtgcgcggcaacgccaccctgttcatgcggcgc
gacgaggtcgaggccgcctgggaatggaccgaatccatcctggatgcctggaaatccgcc
ggcgaccgtcccaagctctacaccgccggcacctggggcccgtccgaggcggtggcgatg
atcgtccgcgacggccgcacctggttcgacgaacaggccggctacggcgccggcgactga

DBGET integrated database retrieval system