KEGG   Acidiphilium multivorum: ACMV_06360Help
Entry
ACMV_06360        CDS       T01446                                 

Gene name
emrB
Definition
(GenBank) multidrug resistance protein
  KO
K03446  MFS transporter, DHA2 family, multidrug resistance protein
Organism
amv  Acidiphilium multivorum
Brite
KEGG Orthology (KO) [BR:amv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:amv02000]
    ACMV_06360 (emrB)
Transporters [BR:amv02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-2 (14 spanner) (DHA2) family [TC:2.A.1.3]
    ACMV_06360 (emrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr TRI12
Motif
Other DBs
NCBI-ProteinID: BAJ79983
NITE: ACMV_06360
UniProt: F0J4D1
Position
718686..720236
Genome map
AA seq 516 aa AA seqDB search
MSLLYASRPNTPRSAAGLYNPWLIVAMVALAPFMEVLDTTIANVALTHIAGSLAVSPDES
TWVLTSYLVSNSIILPITGWLQDVVGRKRLFLICVALFTASSVFCAVSTSLTMLIVARVL
QGLGGGGLQPITQSMYADSFPAEKRAQVFAVFGLVIIVAPATGPILGGWLTDHLSWHWVF
LINLPIGLIAFTLIAIFVDEPELLVRERAARLAGGLRFDWLGLLLVAVGFGALQIFLDKF
SIDDGFGSFFIRSLFAVWAVSLSTLVVWEWGHPEPVVNVRLFAHRNFAISCLVMFVIGFI
LLSTTQLLPQLTQTLMGYSSETAGFALALGGLATIGLMPLAGVVTGRIIPARVLLVGGLV
ETGIALIFQSHLAPNASFYTISIDRVLQVIALPFLFIPISALSYVGLPPARNGDASAIIN
QVRNIGGSIGISFVTTLLAWRTQFHHARLAESVTPYASLHGQTLSQIGAAVQHQAAFMSY
LDLFHILGLMALLVWPVVLLLSTPSSPAAEGVVYEI
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgctctacgcctcccggccgaacacgccgcgttcggctgcggggctctacaac
ccctggctgatcgtggcgatggtggcgctcgccccgttcatggaggtgctcgacaccacc
atcgccaatgtcgcgctcacccatatcgccggctcgctggcggtcagccccgacgaaagc
acctgggtgctgacctcctacctcgtctcgaacagcatcatactgccgatcaccggctgg
ctgcaggacgtcgtcggccgcaagcggctgttcctgatctgcgtggcgctgttcaccgcg
agttccgtcttctgcgcggtctccacctcgctgaccatgctgatcgtcgcccgtgtgctt
caggggcttggcggcggcggcctgcagcccatcacccagtcgatgtatgccgacagtttc
cccgccgagaagcgcgcccaggtcttcgccgtgttcggcctcgtcatcatcgtcgccccg
gccaccggcccgatcctcggcggctggctgaccgaccatctctcgtggcactgggtgttc
ctgatcaacctgccgatcgggctgatcgccttcaccctgatcgcgatattcgtcgacgag
ccggaacttctggtccgcgagcgcgcggcgcgcctcgccggcggcctgcgcttcgactgg
ctcggcctgctgctggtcgccgtcggcttcggcgcgctgcagatcttcctcgacaagttc
tcgatcgatgacgggttcggcagcttcttcattcgcagcctgttcgcggtctgggcggtc
tcgctctccaccctggtcgtctgggaatggggccaccccgagccggtggtgaacgtgcgc
ctcttcgcccatcgcaatttcgcgatttcctgcctcgtgatgttcgtgatcggcttcatc
ctgctcagcaccacccagctcctgccccagctgacccagacgctgatgggctactcctcc
gaaaccgcgggtttcgcgctggcgctgggcggcctcgccacgatcgggctgatgccgctg
gccggcgtcgtcaccggccggatcatccccgcccgggtgcttctggtcggcggcctggtc
gaaaccggcatcgcgctgatcttccagtcccacctcgcgccgaatgcctcgttctatacg
atctcgatcgatcgcgtcctgcaggtgatcgcgctgccctttctgttcatcccgatctcg
gcgctctcctatgtcggcctgccgccggcccgcaacggcgacgcctcggcgatcatcaac
caggtccgcaacatcggcggcagcatcggcatctccttcgtcaccacgctgctggcctgg
cgcacccagttccaccatgccaggctggcagagtccgtcacaccgtatgccagcctgcac
ggtcagaccctttcgcagatcggcgcggcggtgcaacatcaggcagcattcatgagctat
cttgacctgttccacattctgggcctgatggccctgctggtctggccggtcgtgctgctg
ctgagcaccccgtcgagtcccgctgccgaaggagtcgtctatgagatctga

DBGET integrated database retrieval system