KEGG   Acidiphilium multivorum: ACMV_06430Help
Entry
ACMV_06430        CDS       T01446                                 

Definition
(GenBank) beta-glucosidase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
amv  Acidiphilium multivorum
Pathway
amv00460  Cyanoamino acid metabolism
amv00500  Starch and sucrose metabolism
amv01100  Metabolic pathways
amv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ACMV_06430
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    ACMV_06430
Enzymes [BR:amv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     ACMV_06430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 NPCBM_assoc Fn3-like
Motif
Other DBs
NCBI-ProteinID: BAJ79990
NITE: ACMV_06430
UniProt: F0J4D8
Position
complement(728262..731045)
Genome map
AA seq 927 aa AA seqDB search
MRRMPLAALLSLSAIVAVRAAHAAPQAAGCAWRNDHLSTARRTALLLHALTPGDETDLIA
GAGTHEPYVFYTRGLKRFCIPPMGLEDGPAGVGDKLGGVTALPAGVALAATWDPSLARRY
GAVIGAEQKAKGTAVDLGPTVNIDRDPRWGRSFESLSEDPYLAARIGVAEIRGIQSTGVM
AQVKHFAVYNQETYRNTPEDDVIVSPRALHEIYLPAFRAAVRRAHVASIMCGYATIGGHE
SCGDKALLTGVLRADWGFRGFVTSDYQAIHATADAAAGADMEQPFATYFGARLTQAVAAG
KLARSVPETMTRHILAEMFRFRLFDHPPQGSTTAIVATRADRLAATRIAEAGTVLLKNDG
NVLPLDPGHGGTIAVIGPAASIQPVYAGGGSANVVPMQPVPPLAGIDHAPGMTRHVDYVA
GLPADKALTPIPPSALSGPFRPTPLHGSFQAVLTAPETGTYVLGITNPCHCYAPTDLSLD
GRELLSDPGTPPVSTYSAAVQLRKGERYRLGVTGAASRLTWATPSTLRPDIARAVAAARR
AAVAIVVVADDTESEAADRPDLDLPSAQNRLIEAVSSANPHTVVVIDAGAPVAMPWLGKV
AAVVDAWYPGETNGTALAAILFGKADPGGHLPVTFPAHLADMPTAPVARFPGTGGRVDYS
EGIDVGYRWYSAHHVRPLFPFGFGLSYTHFAFSDLKVVSGPGDGTRPVVVSALVTNAGKV
AGSDVAQLYLRFPRSAGEAPLKLVGFRRVRLAPGQSKRLRFTVTPRQTWWWHGSGWTASP
GTYRLYLGDAADDAHLAQRVSFPMPQTVGARNVLVEAPEQAIPGQPVKVKVSLSAGGEAT
LRHVRLRLDAPAGWRVSAIGSAAGEGIQPGEAVRATFTVTSPGWAAAGTYALRAVAQLGA
RHCTRGADAGCVTATRDSGAMITLAAR
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
atgcgccggatgccccttgccgctctactgtccctctcggcgatcgtggcggtccgcgcc
gcccatgccgccccgcaagcggcgggatgcgcctggcgcaacgaccatctttcgacggca
cgccgcacggcgctgctgctccatgccctgacgcccggcgacgagacggatctgattgcc
ggagcgggaacgcatgaaccctacgtgttctacaccaggggactcaagcggttctgcatt
ccgcccatgggtctcgaggatgggccagccggtgtcggcgacaagctcggcggcgtcacg
gccctgcccgccggcgtggcgctcgccgcgacctgggatccgtcgctcgcgcggcgctac
ggggcggtgatcggcgccgagcagaaggcgaagggaaccgccgtcgatctcgggccgacc
gtgaacatcgatcgcgatccgcgctgggggcggtctttcgaatccctctcggaagaccct
tatctggccgcccggatcggcgttgccgagatccggggcatccagtccaccggcgtcatg
gcgcaagtgaagcacttcgccgtctacaaccaggagacctatcgcaacaccccggaggac
gacgtcatcgtctcgccccgcgcgctgcatgaaatctacctccccgcctttcgcgccgcc
gtgcggcgcgcccatgtggcctcgatcatgtgcggctatgcgacgatcggggggcatgag
agttgcggcgacaaggcgttgctgaccggcgtgctgcgcgcggactggggattccgcggc
ttcgtcacctccgactatcaggccattcacgcaacggccgacgcggccgccggcgccgat
atggagcagcccttcgcgacctatttcggcgcgcggctgacgcaggcggtcgcggccgga
aagctcgcccgcagcgtgccggagacgatgacgcggcatatcctcgccgaaatgttccgc
ttcaggctgttcgatcatccgccccagggcagcaccacggccatcgtcgcgacccgggcg
gatcgcctggcggcgacccggatcgccgaagccgggacggtgctgctcaagaatgatgga
aacgtcctgccgctcgatccgggccatggcgggacgatcgcggtcatcgggcccgccgca
tcgatccagcctgtctacgccggcggcggcagcgccaacgtggtgcccatgcagccggtc
ccgccgctcgccggcatcgatcacgcgccggggatgacgcgccacgtcgactacgtggcg
ggattgcccgccgacaaggcgctgacgccgatcccgccctcggcgctttcgggtccgttc
cggcccacgcccctgcacggttcgttccaggccgtgctcaccgcgccggagaccggcacc
tacgtgctcggcatcaccaacccgtgccattgctatgcgcccaccgatctctcgctcgat
ggcagggaattgctgagcgatcccggcacgccgccggtttccacctattccgccgcggtg
caactgcggaagggcgagcggtacaggctcggcgtcaccggcgccgcgtcgcgcctgacc
tgggccacgccatcgaccctgcggcccgatatcgcgcgcgcggtcgcggcggcgcgacgg
gccgccgtcgccatcgtggtggtggcggacgacaccgagtcggaagcggcggacaggccc
gatctcgacctgccatccgcccagaaccgactgatcgaggcggtgtcatcggcaaatccg
cacacggtcgtggtcatcgatgccggagcgccggtcgccatgccctggctcggcaaggtc
gccgcggtcgttgatgcgtggtatccgggcgagaccaacggaacggccctggccgcgatc
ctgttcggcaaggccgatcccggcgggcacctgccggtcacgttccccgcacacctcgcc
gacatgccgaccgcgccggtggcgcgctttcccggcacgggcggcagggtcgactattcc
gagggaatcgacgtcggctatcgctggtattcggcgcatcatgtcaggccgctgttcccg
ttcgggtttggcctctcctacacgcatttcgcgttcagcgacctgaaggtcgtctccggc
cccggcgacgggacacgcccggtcgtcgtatccgccctcgtcacgaatgccggcaaggtt
gccggcagcgacgtcgcccagctctatctccgcttcccgcgcagcgcgggcgaggcgccc
ctcaagctcgtcggcttccgccgcgtccggcttgctccggggcagtcgaagcgtctccgc
ttcacggtgacgccgcgacagacctggtggtggcacggctcgggctggacggcctcgccc
ggcacctatcggctgtatctcggcgatgccgccgacgatgcccatctcgcgcaacgcgtt
tcgttcccgatgccgcagacggtcggcgcccggaatgtgctggtcgaggcgccggaacag
gccatccccggccagcccgtcaaggtgaaggtgtcgctctcggccggcggcgaggcgacg
ctccggcatgtgcggctgaggctcgacgcgccggcgggatggcgggtttccgccatcggt
tccgcggcaggggaaggcatccagcctggagaggcggttcgcgcgaccttcacggtcacg
tcccccggctgggcggcggcggggacctatgcgctgcgggcggttgcgcaactcggcgcg
agacattgcaccaggggggccgacgctggatgtgtcacggcgacgcgggacagcggcgcg
atgatcacgctcgcggcccgatga

DBGET integrated database retrieval system