KEGG   Acidiphilium multivorum: ACMV_06440Help
Entry
ACMV_06440        CDS       T01446                                 

Gene name
bcsA
Definition
(GenBank) cellulose synthase catalytic subunit [UDP-forming]
  KO
K00694  cellulose synthase (UDP-forming) [EC:2.4.1.12]
Organism
amv  Acidiphilium multivorum
Pathway
amv00500  Starch and sucrose metabolism
amv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ACMV_06440 (bcsA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:amv01003]
    ACMV_06440 (bcsA)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:amv02000]
    ACMV_06440 (bcsA)
Enzymes [BR:amv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.12  cellulose synthase (UDP-forming)
     ACMV_06440 (bcsA)
Glycosyltransferases [BR:amv01003]
 Polysaccharide
  Structural polysaccharide
   ACMV_06440 (bcsA)
Transporters [BR:amv02000]
 Other Transporters
  Others
   ACMV_06440 (bcsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_trans_2_3 Glyco_transf_21 Cellulose_synt PilZ
Motif
Other DBs
NCBI-ProteinID: BAJ79991
NITE: ACMV_06440
UniProt: F0J4D9
Position
complement(731055..733331)
Genome map
AA seq 758 aa AA seqDB search
MMRHLPALTNGLTFIVASAVGFVLIAATLLPTTGPLPDIEQGVVFGLLLILYNLDGGCRS
RRKRPIVRISISALTILLTCRYLDWRLTDTLPFGFGTINIALGILLVLAELHGIGSAIMG
QIINVLPLDRTPQHFTLDPASCPTVDILIPTYNEDPEIVETTVIAATQIDYPASRFRVYI
LDDGGTDAKRAKPGAAGREAARRAETLREIARKFGAIYLTRPENVHAKAGNINHALGQID
GELILVLDCDHVPTRDFLSRTVGFFQADPKLFLLQTPHNFVTPDPIERNLSTFEVMPAEN
ELFYHVMQPGLDFWGAAFFCGSAAVLRRHVLDEIGGISGKSITEDAETTVKAMCRGYRTA
FYNRPMVSGLQPETFSGFILQRVRWAQGMMQIFMLDNVWLKSGLTFMQRLLFTNFAFYWL
FPISRSILLLMPPLFLFFGFNVAATTPRQLLVYALPYYLAALVNSQYFYGRVRWPFISQV
YETAQTVFLSAALVSVLRRPRAPKFKVTPKGEMLDKDFISGLSWPFYWLFALACASLGIG
LWRIVTQPQLRWALIFVVFWVVLDMIALLGVIGALAERRQTRTMPRIGCKGPAWMHRDGG
GWVEAALHDLGRGGAGLVLAAGTEGPQPGDRVRLHVPGLRGGLPAVVRHRKDGARNSIIG
LQYVSDGVAEARAAVDRAFGDSELLVRNAALRHRGTSIAYAFGFLFAIGLRGTARHFRIL
ARDAAITLRVSRQRRALLASSRQAEENGGQKARLAPLS
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgccatctccccgcgttgaccaatggcctcaccttcatcgtcgcctcagccgtg
ggcttcgtgctcatcgccgccacgctgctgcccacgacggggcccctgcccgatatcgaa
cagggcgtcgtcttcggcctgctgctgatcctctacaatctcgatggcggatgccggagc
cggcgcaagcggccgatcgtgcgcatctccatcagcgccctgaccatcctgctgacgtgc
cgttatctggactggcggctgaccgacacgctgccgttcgggttcggcacgatcaacatc
gccctcggcattcttctcgtgctcgccgaactgcacggcatcggctcggccatcatgggg
cagatcatcaacgtgctgcctctcgacaggacgcctcagcatttcacgctcgaccccgcg
tcctgccccaccgtggacatcctcatccccacctacaacgaggatcccgagatcgtcgaa
accacggtgatcgcggcaacgcagatcgactatcccgcttcgaggttcagggtctacatc
ctcgacgatggcggcacggatgcgaagcgcgcgaagccgggcgccgccggacgggaggcg
gcgcggcgggcggagacgctgcgcgagatcgcgcggaaattcggcgcgatctatctcacg
cggccggaaaacgttcacgccaaggccggcaacatcaatcacgcgctcggccagatcgac
ggcgagctgattctcgttctggattgcgaccacgtgccgacgcgggacttcctttcgcgc
accgtcgggttcttccaggccgatccgaaactgttcctgctccagacgccgcacaatttc
gtgacgcccgatccgatcgagcgcaatctttcgaccttcgaggtgatgccggccgaaaac
gagctcttctaccatgtgatgcagcccggcctcgatttctggggggcggcgttcttctgc
ggctctgcggccgtcctgcggcgccatgtcctcgacgagatcggggggatctcgggcaag
tcgatcaccgaggacgcggaaaccaccgtgaaggcgatgtgccgcggctaccggacggcg
ttctacaaccggccgatggtctccggcctgcagccggaaacgttctccggcttcatcctc
cagcgggtgcgctgggcgcagggcatgatgcagatcttcatgctcgacaatgtctggctg
aaatcgggcctgaccttcatgcagcggctgctgttcaccaacttcgccttctactggctg
ttcccgatctcgcggagcatcctcctgctgatgccgccgctgttcctgttcttcgggttc
aacgtcgcggcgaccacgccacgccagttgctggtctatgccctgccctactacctcgcg
gcgctggtcaacagccagtatttctacgggcgcgtgcgctggccgttcatttcccaggtc
tacgagacggcgcagaccgtctttctttcggcggccctggtctcggtgctgcggcggccg
cgcgcgccgaaattcaaggtcacgccgaagggcgaaatgctggacaaggatttcatctcc
ggcctgtcctggcctttctactggctgtttgccctggcctgcgcctccctcggtatcggg
ctctggcgcatcgtgacccagccgcagctgcgctgggcgctgatcttcgtcgtgttctgg
gtcgtgctcgacatgatcgccctgctcggcgtgatcggcgcgctggcggaacggcgccag
acgcgcacgatgccgcgcatcggctgcaaggggccggcctggatgcatcgcgacggcggc
ggctgggtcgaggcggcgttgcacgacctcggccgcggcggcgccgggttggtccttgcc
gccggaacggagggcccgcagcccggagaccgtgtgcgcctgcacgttccgggcctgcgc
ggcgggcttcccgcggtggtgcggcaccgcaaggatggcgcacgcaacagcatcatcggg
ctgcaatacgtatccgatggtgtcgccgaggcgcgggccgcggtggaccgggcgttcggc
gacagcgagctgctcgtccgcaacgccgccctccggcaccggggcacgagcatcgcgtat
gccttcggctttctcttcgccatcggattgcgcggtacggcgaggcatttccggatcctc
gcacgcgacgccgcgatcacgctgcgggtgtcgcgccagcgccgggccctgcttgccagc
agccggcaggccgaggagaacggcggccagaaggctcgcctcgcccccttgtcatag

DBGET integrated database retrieval system