KEGG   Acidiphilium multivorum: ACMV_06460Help
Entry
ACMV_06460        CDS       T01446                                 

Definition
(GenBank) hypothetical protein
Organism
amv  Acidiphilium multivorum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBP_BcsS
Motif
Other DBs
NCBI-ProteinID: BAJ79993
NITE: ACMV_06460
UniProt: F0J4E1
Position
complement(734463..735197)
Genome map
AA seq 244 aa AA seqDB search
MKSASLRRTARRATRAGIVTCISTIAITATARAAPHTNLFIAGGQYANSSQSAYLGAILP
LPGGTLGKGFFVSPFAGWNRYTFQKNGQSFTGSEPSASVAIGHAWDEPDFNLSLSVAGGY
SNTTVTPYAPKGSFHGGQWFAEPEIYAQLKLPAGATATVNGGYLTGMRSYWSSAYLLVPV
SPSIAIGPEADFGGGINYRSRTFALRVADKLTSSLDVDLSAGATTNLPGPYHPYVALNLS
VPFR
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccgcaagtttgcgccgcaccgcgcggcgcgcgaccagggccgggatcgtcacc
tgcatctcgaccatcgcgatcaccgcaaccgcgcgggccgccccgcacacgaacctgttc
atcgccggcggccagtatgccaactcgtcgcagagcgcgtatctcggcgcgatcctgcca
ttgccgggcggaacgctgggcaaggggttcttcgtctcgccgttcgccggctggaaccgc
tacaccttccagaagaacgggcagagcttcaccggaagcgagccgtccgcgagtgtcgcc
atcggccacgcctgggacgagccggatttcaacctgagcctttcggtagccggcgggtat
tcgaataccaccgtgacgccctatgcgccgaagggatcgttccacggcggccagtggttc
gcggagccggaaatctatgcccagctcaagcttccggccggggccacggcaaccgtgaac
ggcggctacctgaccggcatgcggagctactggagcagcgcctacctgctggtgccggtt
tcgccctcgatcgcgatcgggcccgaggccgatttcggcggcggcatcaactatcgttcc
cgcaccttcgcgctgcgcgttgccgacaagctgaccagttccctcgatgtcgatctgtcc
gccggcgcgacgacgaaccttccgggtccgtatcacccgtatgtcgccctgaatctcagc
gtgccgttccggtaa

DBGET integrated database retrieval system