KEGG   Acidiphilium multivorum: ACMV_06470Help
Entry
ACMV_06470        CDS       T01446                                 

Definition
(GenBank) cellulose synthase family protein
  KO
K20541  cellulose synthase operon protein B
Organism
amv  Acidiphilium multivorum
Brite
KEGG Orthology (KO) [BR:amv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:amv02000]
    ACMV_06470
Transporters [BR:amv02000]
 Other Transporters
  Others
   ACMV_06470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BcsB
Motif
Other DBs
NCBI-ProteinID: BAJ79994
NITE: ACMV_06470
UniProt: F0J4E2
Position
complement(735194..737464)
Genome map
AA seq 756 aa AA seqDB search
MPCPDRPGHGLPARFQPARWAAGLALALPLCCQPAQARLEHRQSEVRSGAGIPATAISHP
LAWYDRDRAPIVLKGRSASGDITFQVADHREVSAAELHLLGTNSASLIGGASQLLVLLNG
SPLKQIPLDGSSPTIDRTIGIPPGDLRDGTNQLTLSVTQKAAQGCEAFDDPALWTRISPK
SQLSMSYRRDSVPLTLASLKSSFMSWQPDTSHIFVLYDPALARAPEPIMAIARSVARADA
MRAVSFVARPLDRVGKAVAQTSAATVIILKLENGAAAGSGLDAATLSIARNPVGGVVMTI
AAETPRALTGAARLIGRPGTVWPNEQSAVIRIPAATGHMQSPHAPAASPTDISFRATGLP
TQTEHGRSSQFAPVTFWNPNWDSHAILYLHMAYSAGGGAGSMIQALVNGKMVNTIPLTNP
DGGTYPDYKLLVPQDALKVGRNRLVLKPVFHMQHAAASACVANDFGHNLAVTVFSDSHLT
IIGGAPVDKDDLAAMTTGVYPLRTIAIASPSPAAISAAATLGAKLAQVTPDQPLNLVLEP
HPAAKPGVLVVGAVSRLPEQLLSASGISLVGGSPAVKEPSGRTPHVPDAADLDDVTAWLG
RIFGNRAESAPTGKTGHGQAADATVQGFGNAAIMAVADAPAVPDAPGRLAPAIVLTAKSD
AGLAQAMGKLVHTATWRQISGQAIVVAPAKSELQVLPAENVPIGPSARLGFLATRNPLTT
VLAVLGTLVILILLVRTFVTLRRRRLHPSVKGVDER
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgccctgcccagatcggcccggtcatgggctgcctgcccgcttccagcccgcacgctgg
gctgccggactggcgctggcgctgccactctgctgccaacccgctcaggcgcgcctcgaa
caccgccagagcgaggtccggtccggggcaggcattcccgcgacggcgatttcccatccg
ctggcctggtatgaccgcgatcgggccccgatcgtcctgaagggacgctcggcttcgggc
gacatcacgttccaggtggccgatcatcgggaggtttcggccgccgagctgcatcttctc
ggcaccaattccgcatcgctgatcggtggcgcctcgcaattgctggtgctgctgaacggc
tcgccgctgaaacagatcccgctcgacggctcgtcgccgacgatcgaccggaccatcggc
attccacccggcgatctgcgggatggaacgaaccagctcaccctgtcggtcacgcaaaag
gcggcgcagggctgcgaggcgttcgatgaccccgcgctgtggacacggatttcgccgaag
tcgcaactgtcgatgagctaccggcgggactcggttcccctcaccctcgccagcctgaag
tcgagcttcatgtcgtggcagccggatacgtcccacatattcgtcctctacgatcccgcg
ctcgcgcgcgcgccggaaccgatcatggcgatcgcgcggtcggtggcgcgggccgacgcg
atgcgcgcggtgtccttcgtcgcgcggccgctcgaccgggtcggcaaggccgtggcgcag
acatcggccgcgaccgtgatcatcctcaagctggagaacggagcggccgccggcagcggg
ctcgacgccgcgacgctgtcgatcgcccgcaatccggtcggtggggtcgtgatgaccatt
gccgcggaaacgccccgcgcccttaccggcgcggcccggctgatcgggcggcccggaacg
gtctggccgaacgaacagagcgccgtcatccgcattccggccgccaccggccacatgcag
agcccgcacgcgccggcagccagcccgaccgatatcagcttccgcgccaccggcctgccg
acacagaccgaacacggccgcagcagccagttcgcgccggtgacattctggaatcccaac
tgggacagccacgcgatcctgtatctccacatggcctattcggccggtggcggggcgggg
tcgatgatccaggcgctggtcaacgggaaaatggtcaacacgattccgctgaccaatccc
gatggcggcacctatcccgattacaagctgctggttccgcaggatgccctgaaggtgggg
cggaaccgcctggtgctgaagccggtctttcacatgcagcacgcggcggcctctgcctgc
gtcgccaatgatttcggtcacaacctggcggtgacggtgttctcggacagccacctgacc
atcatcggcggcgcgccggtcgacaaggacgatctcgcggcgatgaccacgggcgtgtat
cccctgcgcacgatcgcgatcgcctctccctctccggcggcgatctccgccgccgccacc
ctcggtgcgaagctggcccaggtcacgccggatcagccgctgaacctcgtgcttgaaccc
caccccgccgcgaagccgggggtgctggtcgtcggcgcggtctcgcggctgccggagcaa
cttctgtcggcgagcggcatatcgctcgtgggcggctcgcccgccgtgaaggagccctcc
ggccggacgccgcatgttcccgacgcggcggacctggacgacgtgaccgcgtggctgggc
cgcatcttcggcaacagggccgaaagcgcgcccaccggcaagaccggccacggccaggcc
gccgacgcgacggtgcagggcttcggcaatgccgcgatcatggcggtcgccgacgctccc
gcggtgcccgatgcgccggggcggctcgctcccgccatcgtgctgacggcgaagagcgat
gccgggctggcgcaggcgatgggcaagctggtccacaccgcgacatggcggcagatttcc
ggccaggcgatcgtggtcgcgccggccaagagcgagttgcaggtcctgccggcggagaac
gtgccgatcgggccttccgcgcggctcggcttcctcgccacacgcaatcccctgaccacc
gtattggccgtgcttggcacgctggtgatcctgatcctgctggtccggaccttcgtgacg
ctcaggcggcggcggctgcacccctcagtaaaaggagtcgacgagcgatga

DBGET integrated database retrieval system