KEGG   Acidiphilium multivorum: ACMV_06490Help
Entry
ACMV_06490        CDS       T01446                                 

Gene name
ctrA
Definition
(GenBank) cell cycle response regulator CtrA
  KO
K13584  two-component system, cell cycle response regulator CtrA
Organism
amv  Acidiphilium multivorum
Pathway
amv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:amv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ACMV_06490 (ctrA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:amv02022]
    ACMV_06490 (ctrA)
Two-component system [BR:amv02022]
 Cell cycle family
  CckA-CtrA/CpdR [MD:M00512]
   ACMV_06490 (ctrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trans_reg_C Response_reg
Motif
Other DBs
NCBI-ProteinID: BAJ79996
NITE: ACMV_06490
UniProt: F0J4E4
Position
complement(738636..739388)
Genome map
AA seq 250 aa AA seqDB search
MRLLIFGKTFDRHDSLNSFIKSKLAVIDETADVDEAVDLTHHYEYEAVVMRVFDTYRIEF
DLIRRLRKSGFRAPIVAVANTLAESARLHILEAGVDDLIVGAPSYEETFLRIQNHIRRNR
GFQDSSLSVGNIEVNMNAKKVFVGAREVAVTKKEYQIIELLALRKGCVLSKEAILDHLYG
GLDEPNAKIIDVFICKIRKKLLAADGQDVLVTNWGRGYMMADQRPQNMVQTVTAPGIQAR
IKTTASLAVA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcggcttctcatttttggtaaaacgttcgacaggcacgacagcctgaacagcttcatc
aagtcgaaactcgccgtcatcgacgagacggcagacgtcgacgaagcggtcgatctcacc
catcattacgaatatgaagcggtggtgatgcgggtcttcgatacctacaggatcgagttc
gacctgatccgccgcctgcggaaatccggatttcgcgccccgatcgtggcggtcgccaac
acgctggccgagtccgcccgcctgcatattcttgaggccggggtcgacgatctcatcgtc
ggcgctccctcatacgaggaaacgttcctgcgcatccagaatcatatacgcaggaaccgg
ggcttccaggactcttcactttccgttggcaatatcgaggtcaacatgaatgcgaagaag
gtctttgtcggcgcccgcgaagtcgccgtcacgaagaaggagtatcagatcatcgaactc
ctcgcgctgcgcaagggctgcgttctgagcaaggaagcgatcctcgatcatctgtacggc
ggcctcgacgaaccgaacgccaagatcatcgacgtgttcatctgcaagatccgcaagaag
ctgcttgccgcagacggccaggacgtgctcgtcaccaactggggacgcggctatatgatg
gccgaccagcgcccccagaacatggttcagacggtgaccgcgccgggcatccaagccagg
atcaagacgactgcaagccttgcagtcgcttga

DBGET integrated database retrieval system