KEGG   Acidiphilium multivorum: ACMV_06590Help
Entry
ACMV_06590        CDS       T01446                                 

Definition
(GenBank) hypothetical protein
  KO
K17865  3-hydroxybutyryl-CoA dehydratase [EC:4.2.1.55]
Organism
amv  Acidiphilium multivorum
Pathway
amv00630  Glyoxylate and dicarboxylate metabolism
amv00650  Butanoate metabolism
amv01120  Microbial metabolism in diverse environments
amv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ACMV_06590
   00650 Butanoate metabolism
    ACMV_06590
Enzymes [BR:amv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.55  3-hydroxybutyryl-CoA dehydratase
     ACMV_06590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MaoC_dehydratas MaoC_dehydrat_N 4HBT
Motif
Other DBs
NCBI-ProteinID: BAJ80006
NITE: ACMV_06590
UniProt: F0J4F4
Position
complement(748972..749472)
Genome map
AA seq 166 aa AA seqDB search
MCAAIRSTATGVPMPSCVPFDQLEPGQTASLGKTITEADILLFSAVSMDTNPVHLNQELA
DETLFKGRVAHGMLCGSLISAVLGTVLPGLGTIYLTQSMRFRAPVRIGDTVTAEVEVASL
DHEKKRATMRTRCFVRGKVVIEGEAVVIPPTEAVVAVAQNEKRAAE
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
ttgtgcgccgcgatacgttccaccgcgacgggagttcccatgcccagctgcgtacccttc
gaccagctcgaacccggccagaccgcctcgctcggcaagaccatcaccgaggccgacatc
ctgctgttttccgccgtgtcgatggacacgaatccggttcacctgaaccaggagctcgcc
gacgagacgctgttcaagggacgggtcgcgcacgggatgctgtgcggcagcctgatttcg
gcggtgctcggcaccgtgctgccgggattggggacgatctatctcacgcagtcgatgcgg
ttccgcgcgccggtgcgcatcggcgacacggtgacggcagaggtcgaggttgcctcgctc
gatcacgagaaaaagcgggcgaccatgcgcacgcgctgcttcgtgcgcggcaaggtggtg
atcgagggcgaggcggtcgtgattccgccgaccgaggccgtcgtcgccgtggcgcagaac
gagaagcgcgccgccgaatga

DBGET integrated database retrieval system