KEGG   Acidiphilium multivorum: ACMV_06830Help
Entry
ACMV_06830        CDS       T01446                                 

Definition
(GenBank) hypothetical protein
  KO
K09137  uncharacterized protein
Organism
amv  Acidiphilium multivorum
Brite
KEGG Orthology (KO) [BR:amv00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    ACMV_06830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF190
Motif
Other DBs
NCBI-ProteinID: BAJ80030
NITE: ACMV_06830
UniProt: F0J4H8
Position
777002..777349
Genome map
AA seq 115 aa AA seqDB search
MRIMEDALLLRVFLGEDDMAGGQPLYRAILEAAMRAGLAGGTALPAPMGFGGSRGIRTGI
NVDAGAHQPIVVEIIDRPDRIEAFLPLIEPMIPSGVVTLEALKMRKIVPGSPAPA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcatggaagatgccctgctgctcagggttttcctgggcgaggacgacatggcc
ggcggccagccgctctatcgcgcgatcctcgaggcggcgatgcgggccgggctggccggc
ggcacggcgctgccggccccgatgggctttggcggctcgcgcggaatcaggacgggcatc
aacgttgatgccggggcgcatcagcccatcgtcgtcgagatcatcgaccggccggaccgg
atcgaggcgttcctgccgctgatcgagccgatgattccgtcgggcgtggtcacgctggag
gcactcaagatgcggaagatcgttcccggttcgccggccccggcctga

DBGET integrated database retrieval system