KEGG   Acidiphilium multivorum: ACMV_06910Help
Entry
ACMV_06910        CDS       T01446                                 

Definition
(GenBank) putative transposase
  KO
K07497  putative transposase
Organism
amv  Acidiphilium multivorum
Brite
KEGG Orthology (KO) [BR:amv00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    ACMV_06910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: rve_3 rve_2
Motif
Other DBs
NCBI-ProteinID: BAJ80038
NITE: ACMV_06910
UniProt: F0J4I6
Position
782090..782437
Genome map
AA seq 115 aa AA seqDB search
MQNGDVESFSGRMRDELLNESLFFGLDHARAAIADWVAHFNAARPHSSLGYQTPADYAEG
LTTTGTERRNRSGRDSNRTRMKVRGRVRDILFRPFARPLAAGARRRILWTESSYR
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacggcgatgtcgaatccttcagcggccgcatgcgcgacgagcttttgaacgag
agcctgttcttcggcctcgatcatgcccgcgccgccatcgctgattgggtggcgcatttc
aatgccgcgaggccgcactcctcgctcggctaccagaccccggcggactatgccgagggc
ctcaccacaaccggcaccgaacggcgtaacagaagcggccgagactccaatcgcacacgg
atgaaagttcggggacgggtcagagacattcttttcaggccattcgcgcgcccccttgcc
gcaggggcgcggcggcgcatactctggaccgagagctcatacaggtga

DBGET integrated database retrieval system