KEGG   Acidiphilium multivorum: ACMV_06990Help
Entry
ACMV_06990        CDS       T01446                                 

Gene name
pepA
Definition
(GenBank) leucyl aminopeptidase
  KO
K01255  leucyl aminopeptidase [EC:3.4.11.1]
Organism
amv  Acidiphilium multivorum
Pathway
amv00480  Glutathione metabolism
amv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ACMV_06990 (pepA)
Enzymes [BR:amv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.1  leucyl aminopeptidase
     ACMV_06990 (pepA)
Peptidases [BR:amv01002]
 Metallo Peptidases
  Family M17: leucyl aminopeptidase family
   ACMV_06990 (pepA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M17 Peptidase_M17_N
Motif
Other DBs
NCBI-ProteinID: BAJ80046
NITE: ACMV_06990
UniProt: F0J4J4
Position
complement(791467..793011)
Genome map
AA seq 514 aa AA seqDB search
MIDIGFAKPALPESGALALLLAEGAALDGVAAALDAALEGGLTRAMAAARFTGKRGQTAT
LIAPGAGLDRVVLVGLGAADDVTPHRAESAGATAAAALLKEPSASLAADALDPALLAHAA
LGARLRSYRFDRYRTRQKEEQKPKLANLAVLASDTAATRTAFAPLAALAAGVELTRDLVS
EPANILTPAEMADRAKTLKSLGVKVEVMDQRDLEKLGFGALLGVARGSVNEPRVVVMQWL
GASEPEAPARGRKAQAKQAAKPARKERAVPHDPLVFIGKGVTFDTGGISLKPAAGMEDMK
WDMAGAGTVIGLMAALAGRKARVDAVGLVGLVENMPSGSAQRPGDVVTSYSGQTIEVLNT
DAEGRLVLADVLAYAQERFQPRFMIDLATLTGAIIVALGHENAGLFSNDDTLAGQLAEAA
KITGEGVWRMPMGEAYDKLINCDIADMKNIGGGRAGGSITAAQFLQRFVNKVPWAHLDIA
GMAWATKDGAVGPKGATGFGVRLLDRLVADHYER
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatatcggatttgcaaagcccgcgctgcccgaaagcggtgcgctcgccctgctg
ctggccgagggcgcggcgctcgacggtgttgcagcagcattggacgccgccctcgaaggt
gggctcacccgcgcgatggcggcggcgcgcttcaccggcaagcgcgggcagaccgcaacc
ctgatcgcgcccggcgccggtctcgaccgcgtggtgctggtcggcctcggcgccgccgac
gacgtcaccccccaccgcgccgagagcgccggggcgaccgccgccgcggcactgctgaag
gagccgtccgcctcgctcgccgccgacgcgctcgaccctgccctgctcgcccatgccgcc
ctcggcgcgcggctgcgcagctaccggttcgaccgctaccgcacccgccagaaggaggaa
cagaagccgaaactcgcgaacctcgccgtgctggcgtccgatacggcggcgacgcgcacc
gccttcgccccgctcgccgcccttgccgccggcgtggagctgacccgcgatctcgtttcc
gagcccgccaacatcctcaccccggccgagatggccgaccgcgcgaagacgctgaaatcg
ctcggcgtaaaggtcgaggtgatggaccagcgcgaccttgagaaacttggcttcggcgcg
ctgctcggcgtcgcccgcggcagcgtgaacgagccgcgcgtggtggtcatgcaatggctc
ggcgcctccgagcccgaggcgccggcgcgcggccgcaaggcacaggcgaagcaggcggcg
aaacccgcgcgcaaggagcgcgccgtcccgcacgatcctctggtcttcatcggcaagggc
gtgaccttcgataccggcggcatctcgctcaagcccgccgccgggatggaggacatgaaa
tgggacatggccggcgccggcacggtgatcggcctgatggcggcactcgccgggcgcaag
gcgcgggtcgacgcggtcgggctggtcggcctggtcgagaacatgccctccggcagcgcg
cagcggccgggcgatgtcgtgacctcctattccggccagacgatcgaggtgctcaacacc
gacgccgagggccggctggtgctggccgacgtgctggcctacgcgcaggagcggttccag
ccgcgcttcatgatcgacctcgcgacgctgaccggggccatcatcgtggcgctcggccac
gagaatgccggcctgttctcgaacgacgacacgctggccgggcagctcgccgaggcggcg
aagatcaccggcgagggcgtatggcgcatgccgatgggcgaggcctatgacaagctgatc
aactgcgacatcgccgacatgaagaatatcggcggcggccgcgccggcggctcgatcacc
gcggcgcagttcctccagcgcttcgtcaacaaggtgccctgggcgcatctggacatcgcc
ggcatggcctgggcgaccaaggacggcgccgtcggcccgaagggggcgaccggcttcggc
gtccgcctgctcgaccggctggtggcggaccattacgagcgctga

DBGET integrated database retrieval system