KEGG   Acidiphilium multivorum: ACMV_07070Help
Entry
ACMV_07070        CDS       T01446                                 

Definition
(GenBank) hypothetical protein
Organism
amv  Acidiphilium multivorum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1211 SCF
Motif
Other DBs
NCBI-ProteinID: BAJ80054
NITE: ACMV_07070
UniProt: F0J4K2
Position
798315..798932
Genome map
AA seq 205 aa AA seqDB search
MDHEARGGAGRRRMDRDRLAAFSDGVLAIIITVMVLELKTPSGPELAALSASLPTLAGYV
LSFLYVAIYWNNHHHLFQLVERVNGTILWANIHLLFWLSLIPFATGWLGEYPRASGPAAL
YGFVLLMPAIAWKIAQAAIIHAQGPDSPLATVLGRDIKGKISPPLYLAGLVLAFVSPWIA
DGLYALVALLWCVPDRRIEALFDGR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggaccatgaggcgaggggtggagcggggcgccggcgcatggatcgcgatcgccttgcc
gcgttcagcgacggggtgctcgccatcatcatcacggtgatggtgctcgagctgaagacg
ccgtccggccccgagcttgccgcgctgtccgccagcttgccgacgctcgccggctacgtg
ctgagctttctctatgtcgcgatctactggaacaaccaccatcatctcttccagctggtc
gagcgggtgaatggcacgattctctgggccaacatccacctgctgttctggctgtcgctg
atccccttcgccaccggctggctcggcgagtacccccgcgcctcgggcccggcggcgctc
tacggcttcgtcctattgatgccggcgattgcctggaagatcgcgcaggcggcgatcatc
cacgcgcagggtccagactcccctctggcgacggtgcttggtcgcgacatcaaggggaag
atttcaccgccgctctatctcgccggcctggtcctcgccttcgtctcgccctggatcgcc
gatggactttacgctctggtcgccttgttgtggtgcgtgccggaccgtcggatcgaagcg
ttgttcgacgggcgctga

DBGET integrated database retrieval system