KEGG   Acidiphilium multivorum: ACMV_07090Help
Entry
ACMV_07090        CDS       T01446                                 

Definition
(GenBank) putative transposase for insertion sequence element
Organism
amv  Acidiphilium multivorum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_Tnp_IS1595 Zn_Tnp_IS1595
Motif
Other DBs
NCBI-ProteinID: BAJ80056
NITE: ACMV_07090
UniProt: F0IZR7
Position
800138..801154
Genome map
AA seq 338 aa AA seqDB search
MDVLAREDLPFPQSLPEFQRIFPNDAACAAYLESARWNGGFACPRCGVVGEPFRFEARPG
VLRCRACRKDVSLMAGTVMERSHTPLSTWFWAAYLIASQTPGMSAVQFQRQLGLSRYETA
FGILHKLRAGMVRPERDKIGDTPQEHVEVDETWVGGRTRGDGRGVHHKVLVACAVEVRHR
KPGTKLDNRKDGRYAGRVRLAVVPDRSANSLCGFVENAVAPGSLIVTDDWSGYAGLGRRG
FDHHAIAECGDPEVAEEFLPIVHLVFTNLKTWINGIHHGVSAKHLQAYLNEFTFRFNRRL
YPFNAFRSLLGIAGRAAAPTFDELYSGEWTHPTFSGCG
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcctggcccgtgaagacctgccgttcccgcagtctctgccggaattccagcgt
attttcccgaacgacgcggcctgtgccgcctatctcgaaagcgcccgctggaatggaggg
ttcgcctgcccaaggtgcggcgtcgttggcgagccgttccgtttcgaggcgcgcccgggc
gttctgcgctgccgggcctgtcgcaaagacgtaagcctgatggctgggaccgttatggaa
cgcagtcacacgccgctgtcgacttggttctgggcggcttacttgatcgccagccagacg
cccggaatgtcggccgtccaatttcagcggcaactcggcctgtcgcgctacgagaccgcc
ttcggcatccttcataagctgcgcgccgggatggtgcgccccgagcgcgacaagattggc
gacacgccgcaagaacacgtcgaagtggatgaaacgtgggttggaggacgaacccgaggc
gatggacggggtgtccatcacaaggttctcgtcgcctgtgccgtggaggtgcgccaccgg
aaaccgggaaccaagctcgacaatcggaaagacggtcgctacgcgggacgcgttcgtctc
gctgttgtccccgaccgtagcgccaattcgctctgcggattcgtcgaaaacgccgttgct
cccggatcgctgatcgttaccgacgactggagcggctatgccggtctcggaaggcgcggg
ttcgaccaccatgcaatcgccgaatgcggcgacccggaggtggcagaagaattcctgccg
atcgtccacttggtctttaccaacctgaagacctggatcaacggcatccatcacggggtc
agcgccaaacatctacaagcctacctcaatgaattcacgtttcggttcaaccggcgcctc
tatcccttcaacgcgttccgctcgctgctcggaatcgcgggtagggcagccgcaccaacc
tttgacgagctttattccggggaatggacacaccctacatttagtgggtgtgggtaa

DBGET integrated database retrieval system