KEGG   Acidiphilium multivorum: ACMV_07100Help
Entry
ACMV_07100        CDS       T01446                                 

Definition
(GenBank) putative fatty-acid--CoA ligase
  KO
K00666  fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
amv  Acidiphilium multivorum
Brite
KEGG Orthology (KO) [BR:amv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:amv01004]
    ACMV_07100
Enzymes [BR:amv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     ACMV_07100
Lipid biosynthesis proteins [BR:amv01004]
 Acyl-CoA synthetase
  Unknown
   ACMV_07100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: BAJ80057
NITE: ACMV_07100
UniProt: F0J4K5
Position
complement(801138..801722)
Genome map
AA seq 194 aa AA seqDB search
MAVAWGGWYPVRNETPHHAEDTTMTDFITGLEKTEANYQALSPLSFLARTAKVWPERTAI
VHGSIRRTWAETFERCKRLGAALAARGIGPGDVVAVMAPNIPAMVEAHFGVAMAGAVLNT
LNTRLDAPTIAYILRHGEAKLLLSDTEFAPVIAAALAELSDNAPPVIDIDDPEGPGGARL
GAMDLAYPVVTHTH
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcggtagcatggggcggctggtatcctgtccgcaacgaaacgccacaccacgccgag
gacacgaccatgaccgatttcatcaccggcctcgagaagacggaagcgaactaccaggcg
ctgtcgccactctccttcctcgcgcggacagcgaaagtctggccggagcgaacggcgatt
gttcacggctcgatccggcgcacctgggcggaaaccttcgagcgctgcaagcggctgggc
gcggcactggcggcacggggaatcggaccgggcgacgtcgtcgccgtcatggcgcccaac
ataccggcaatggtcgaggcgcatttcggcgtcgccatggcgggcgcggtgctgaacacg
ctgaacacccggctggatgcgccgaccatcgcctacatcctgcgccacggcgaggcgaaa
ctcctgctgagcgacaccgaattcgccccggtgatcgccgcggccctggccgagctcagt
gacaatgctcctccggtgatcgatatcgacgatcccgagggcccaggcggcgcccggttg
ggagcaatggaccttgcctatccggttgttacccacacccactaa

DBGET integrated database retrieval system