KEGG   Acidiphilium multivorum: ACMV_07120Help
Entry
ACMV_07120        CDS       T01446                                 

Gene name
guaB
Definition
(GenBank) inosine-5'-monophosphate dehydrogenase
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Organism
amv  Acidiphilium multivorum
Pathway
amv00230  Purine metabolism
amv01100  Metabolic pathways
amv01110  Biosynthesis of secondary metabolites
Module
amv_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:amv00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ACMV_07120 (guaB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amv04147]
    ACMV_07120 (guaB)
Enzymes [BR:amv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     ACMV_07120 (guaB)
Exosome [BR:amv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ACMV_07120 (guaB)
  Exosomal proteins of breast cancer cells
   ACMV_07120 (guaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IMPDH CBS NMO FMN_dh His_biosynth Glu_synthase ThiG NanE DHO_dh G3P_antiterm QRPTase_C Aldolase IGPS NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: BAJ80059
NITE: ACMV_07120
UniProt: F0J4K7
Position
802542..804041
Genome map
AA seq 499 aa AA seqDB search
MAPSNETFLPRGSDRITEAYAFDDVLLVPGYSSVLPAAVNTRTRLTRSISLNIPVISAAM
DTVTEAPMAIAMAQQGGIGVVHKNLSIEDQADQVRQVKKFESGMVVNPLTIHPEQTLAEA
QALMAQHRISGVPVVERDTNRLVGILTHRDVRFATDPAARVYELMTRENLVTAPANVAPE
VARSLLHKHRIEKLLVVDEDYRCVGLITVKDMDKAEAHPFANKDELGRLRVAAATGVGED
GARRAEALIAAGVDVVVVDTAHGHSEGVLRAVARIKERSNAVQIVAGNVATPEAAAALIK
AGADAVKIGIGPGSICTTRVVAGVGVPQFSAVMETAAACHEADVPAIADGGIRTSGDVVK
ALAAGADCVMIGSLLAGTDEAPGEVFLYQGRSYKSYRGMGSLGAMARGSADRYFQQDIKD
SLKLVPEGIEGRVGYKGPMAGVVHQLVGGLRAGMGYTGCATIADLQTRAQFRRITGAGLR
ESHVHDVAITREAPNYRQD
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggctcccagcaatgagacttttctcccgcgaggctccgaccgcatcacggaggcttat
gccttcgacgatgtgctcctcgttcccggctattcctcggtgctccccgccgcggtcaac
acccgcacgcggctgacccgctccatctcgctcaacattcccgtcatctccgccgcgatg
gacaccgtgacggaggcgccgatggcgatcgccatggcgcagcagggcggcatcggcgtg
gtgcacaagaacctctcgatcgaggatcaggcggaccaggtgcgccaggtcaagaaattc
gagagcggcatggtggtcaacccgctcaccatccaccccgagcagaccctggccgaggcg
caggcgctgatggcccagcatcggatttccggcgttcccgtggtcgagcgcgacaccaac
cgccttgtcggcatccttacccatcgtgacgtccgcttcgcgaccgacccggccgcccgc
gtgtatgagctgatgacgcgcgaaaacctcgtcaccgcgccggccaatgtcgcgcccgag
gtcgcgcggtcgctgctccacaagcaccggatcgagaagctgctggtggtggacgaagac
tatcgctgcgtcggcctgatcaccgtgaaggacatggacaaggccgaggcgcatcccttc
gccaacaaggacgaactcgggcgcctgcgcgttgccgcggcgaccggcgtcggcgaggac
ggggcgcgccgcgccgaggcgctgatcgccgcgggggtggatgtcgtggtggtggatacc
gcgcatggccattcagagggcgtgctgcgcgccgtagcgcgcatcaaggagcgttcgaac
gcggtgcagatcgtcgccggcaacgtcgcgacgcccgaggccgccgcggcgctgatcaag
gcgggtgctgacgcggtgaagatcggcatcggcccgggcagcatctgcaccacccgcgtg
gttgccggcgtcggcgtgccgcagttctcggccgtgatggagaccgccgccgcctgtcac
gaagcggacgtgccggcgatcgccgatggcgggatccgcacctcgggcgacgtggtcaag
gcgctcgccgccggggccgactgcgtgatgatcggctcgctcctcgccggcaccgacgag
gcgcccggcgaggtgtttctctaccagggccggtcctacaagtcctatcgcggcatgggc
agcctgggtgcgatggcccgcggctcggccgaccgctatttccagcaggacatcaaggac
tcgctgaaacttgtgcctgaggggatcgaggggcgcgttggctacaagggcccgatggcc
ggggtggtgcaccagctggtcggcgggctgcgcgccggcatgggctataccggttgcgcc
accatcgccgacctgcagacaagggcgcaattccgccgcatcaccggcgccggcctccgc
gagagccacgttcatgacgtggcgatcacccgcgaggcgccgaattaccggcaggactga

DBGET integrated database retrieval system