KEGG   Acidiphilium multivorum: ACMV_07210Help
Entry
ACMV_07210        CDS       T01446                                 

Definition
(GenBank) putative ABC transporter substrate-binding protein
  KO
K02035  peptide/nickel transport system substrate-binding protein
Organism
amv  Acidiphilium multivorum
Pathway
amv02024  Quorum sensing
Module
amv_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:amv00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ACMV_07210
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:amv02000]
    ACMV_07210
Transporters [BR:amv02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    ACMV_07210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5
Motif
Other DBs
NCBI-ProteinID: BAJ80068
NITE: ACMV_07210
UniProt: F0J4L6
Position
complement(811489..813123)
Genome map
AA seq 544 aa AA seqDB search
MRSRLLAAVILAMVAAGPSFSAGRCDTVVVPPGLGLGTPPASVDSLNPFLIGSAYDAEAA
GLLYDGLLWISRNHTITWSRSIASAIEVSNDKTTFTVTMKPRTWSDGVPVTAEDVKFTFD
LIRKLGKTYTGYGQGGMPGLVKSLNVLGPHRFRVVLKRSVNPTWFELTGLSQLTPFPAHA
WTRYSVNQMWRLQSTPSFFRVVDGPFRIGRYVMGRYISFVPNPTYQGHKPDIRRFIMVFL
NSDGAVFEGLRTGTLDAGNLPFSLWRAQRKLPDARELRLPPNFGFDYMELSYRNPKVAFF
RDVRVRQAIADAIDQKRIIRLLLHGTTKPQHGPVPVDPPTFLSPAAKAGKYPVGYDTAKA
KALLAAAGWKPGPDGIRMKDGKRLAFTDVIPSGNVTGQLGAELIQADLRAVGIAMTIREV
TFSQMLVLSYKPLQWEAMQFGWALGVYPDDSAQLASDGAFNQSGYSDARMDALLKDVQTK
PGLEPLYAYQDYAAAQQPEIFLPEPGSVVLVRNGLEGVRKFLSPTGAWSPQYLHWAPGAC
GGRR
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgcgatcgcgcctgctggcggcggtgattctggccatggtcgcggcagggccgagcttc
agcgcgggacgctgcgacacggtggtggtgccgccggggctcgggctcggcacgccgccg
gcgagcgtcgattcactcaacccgttcctgatcggctccgcctacgatgccgaagccgcc
ggcctgctctatgacgggctgctctggatcagccgcaaccacaccatcacctggtcgcgc
agcatcgcatcggcgatcgaggtctccaatgacaagaccaccttcaccgtgacgatgaag
cctcgcacctggtcggacggcgtaccggtgacggcggaggacgtgaaattcaccttcgac
ctgatccgcaagctcgggaaaacctataccggctacggccagggcggcatgccggggctg
gtgaagtcgctcaacgtgctcgggccgcaccgcttccgggtggtgctgaagcggagcgtg
aacccgacctggttcgaactgaccggcctcagccagctgaccccgtttcccgcccatgcc
tggacccgctattccgtcaaccagatgtggcggctgcaatcgacgccctcgttcttccgg
gtggtggacggccccttccggatcggccgctacgtcatgggccgctacatcagtttcgtg
cccaacccgacctatcagggccacaagccggacatccgtcggttcatcatggtcttcctg
aattcggacggcgcggtgttcgaggggttgcgcaccggcacgctcgatgccggcaacctg
cccttctcgctgtggcgggcgcagcggaagctgcccgacgcgcgggagctgcgactgccg
ccaaatttcggcttcgactacatggaactgagctatcgcaacccgaaagtcgccttcttc
cgcgatgtgcgggtgcgccaggcgattgccgacgcaatcgaccagaagcgaatcatccgc
ctgctcctgcacgggacaacgaagccgcaacacgggccggtgccggtggacccgccgacc
tttctctcgcccgcggcgaaggccgggaaatatcccgtgggttatgacacggcaaaggcg
aaggccctgctcgccgccgcgggctggaaaccgggaccggacggcatcaggatgaaggac
ggcaagcgtcttgccttcaccgacgtgattccctccggcaacgtgaccggccagctcggc
gccgagctgatccaggcggatctgcgcgccgtcggcatcgcgatgacgatccgcgaggtc
acgttcagccagatgctggtgctcagctacaagccacttcaatgggaggcgatgcagttc
ggctgggcgctcggcgtctaccccgacgattccgcccagcttgcaagcgatggcgcgttc
aaccagtccggctacagcgacgcgcggatggacgcgctgctgaaggatgtgcagacgaag
ccgggcctggaaccactctacgcctatcaggattatgcggcggcacagcagccggaaatt
ttcctgcccgagcctggcagcgtggtgctggtgcgcaacgggctcgagggcgtgcggaag
ttcctcagcccgaccggcgcgtggtcaccgcaatacctgcactgggcgccgggcgcgtgt
ggtgggcgccggtga

DBGET integrated database retrieval system