KEGG   Acidiphilium multivorum: ACMV_07230Help
Entry
ACMV_07230        CDS       T01446                                 

Definition
(GenBank) hypothetical protein
  KO
K06923  uncharacterized protein
Organism
amv  Acidiphilium multivorum
Brite
KEGG Orthology (KO) [BR:amv00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    ACMV_07230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF815 AAA_16 AAA RNA_helicase
Motif
Other DBs
NCBI-ProteinID: BAJ80070
NITE: ACMV_07230
UniProt: F0J4L8
Position
complement(813982..814851)
Genome map
AA seq 289 aa AA seqDB search
MDQPTYDLLARIADALDRLAPPPPLPAEVSAHDAYVWHPERAALEPVDQVSRVPIGLLQG
VERQKDILTENTLRFARGLPANNAMLWGARGMGKSSLVKAAHAAANRAFPGSLALIEIHR
EDIATLPALLDILRGQPRQCLILCDDLSFEREDADYKALKSVLDGGIKGRPDNVLFYATS
NRRHLMPRDMIENERSTAIHASEATEEKVSLSDRFGIWLGFHNCDQQTFFAMIEGYAKAF
ALDVDAETLHAEAVEWSVTRGARSGRVAWQFICDLAGRLGRRIEAGAAP
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggaccagccgacatacgacctgctcgcccgcatcgccgatgcgctcgaccgcctcgcc
ccgccgccgccgctgccggccgaggtgagcgcgcacgatgcctatgtctggcatcccgag
cgcgcggcgctggagccggtggatcaggtctcgcgcgtgccgatcgggctgctgcagggc
gtggagcggcagaaggacatcctgaccgagaacacgctgcgcttcgcccgcggcctgccg
gccaacaacgccatgctctggggcgcgcgcgggatgggcaagtcctcgctggtgaaagcg
gcgcatgcggcggcgaaccgggcgtttcccggcagcctcgcgctgatcgagatccatcgc
gaggacatcgccaccctgccggcgctgctcgacatcctgcgcggccagccccgccagtgc
ctgatcctgtgcgacgatctcagcttcgagcgcgaggatgccgactacaaggcactcaaa
tcggtgctcgatggcggcatcaagggccggccggacaacgtgctgttctacgcgacctcg
aaccgtcggcacctgatgccgcgtgacatgatcgagaacgaacgcagcaccgcgatccac
gcctcggaggcgacggaggaaaaagtatcgctgtcggatcgcttcggcatctggctcggg
tttcacaattgtgatcagcagaccttcttcgccatgatcgagggctatgcgaaagcgttc
gccctcgatgtcgacgccgaaaccctccatgcggaggccgtggaatggtcggtgacgcgc
ggcgcccggtcggggcgggtggcctggcagttcatctgcgatctcgccgggcggctcggc
cgccggatcgaggccggcgcggcgccttga

DBGET integrated database retrieval system