KEGG   Acidiphilium multivorum: ACMV_07390Help
Entry
ACMV_07390        CDS       T01446                                 

Gene name
gcl
Definition
(GenBank) glyoxylate carboligase
  KO
K01608  tartronate-semialdehyde synthase [EC:4.1.1.47]
Organism
amv  Acidiphilium multivorum
Pathway
amv00630  Glyoxylate and dicarboxylate metabolism
amv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ACMV_07390 (gcl)
Enzymes [BR:amv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.47  tartronate-semialdehyde synthase
     ACMV_07390 (gcl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: BAJ80086
NITE: ACMV_07390
UniProt: F0J4N4
Position
complement(835763..837547)
Genome map
AA seq 594 aa AA seqDB search
MSRMRAAEAAIRVLEREGATTLFGVPGAAINPLYAAMRGSNAIRHVLARHVEGASHMAEG
FTRAKPGNIGVCVGTSGPAGTDMITGLYSALADSIPILCITGQAPRARLHKEDFQAVDIE
SIAKPVTKWAVTVREPALVPRVFQQAFHVMRSGRPGPVLIDLPIDVQMAEIEFDEETYAP
LPVYRPAATAAQIERALDMLESAERPLIVAGGGVINADAADRLVAFAELTGVPVIPTLMG
WGAIPDDHPLMAGMVGLQTSHRYGNATFLESDFVLGIGNRWANRHTGSIETYTRGRRFVH
VDIEPTQIGRVFEPDYGIVSDAGAALDLFLSLAAERRAAGRLPDRRGWSEACRARKRTML
RRTHFDAAPIKPQRVYEEMNKAFGRETRYVSTIGLSQIAAAQFLHVFRARNWINCGQAGP
LGWTIPAALGAAVAEPDRPVVALSGDYDFQFLIEELAVGAQFSIPYLHVVVNNAYLGLIR
QAQRAFGMDYCVDLAFENINAPEQGPAAASGVDHVAVAEGLGCKALRVTEPDGIAPALIR
AAAMMKAHRVPVVVEIVLERVTNIAMGPEIDSIQEHDELAEHKDDAPTALAFLD
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggatgcgggcggccgaggccgcgatccgcgtattggaacgggagggcgcgacc
accctgttcggcgtgccgggggcggcgatcaatccgctctacgcggcgatgcgcggatcg
aacgcgatacggcatgtcctggcgcgccacgtcgagggcgccagccacatggcggaggga
ttcacccgggcgaagccgggcaatatcggcgtctgcgtcggcacgtccggccccgcgggc
accgacatgatcaccgggctctattccgccctggcggattcgatcccgattctctgcatc
accggccaggcgccgcgcgcccgcctccacaaggaggatttccaggcagtggatatcgag
agcatcgcgaagccggtgaccaaatgggccgtcacggtgcgcgagccggccctggtgccg
cgggtgtttcagcaggcgttccatgtcatgcgctccggccggccggggccggtcctgatc
gacctgccgatcgacgtgcagatggccgagatcgaattcgacgaggaaacctacgcgccg
ctgcccgtctaccggcccgcggcgacggcggcgcagatcgagcgcgcgctcgacatgctg
gagagcgcggaacgcccgctgatcgtggccggtggcggcgtcatcaacgccgatgccgcc
gaccggctggtcgccttcgcggaactgaccggggtgccggtgattccgacgctgatgggc
tggggcgcgatcccggatgatcatccgctgatggccggcatggtcgggctccagaccagc
caccgctacggcaacgcgaccttcctcgaatccgatttcgtgctcggcatcggcaatcgc
tgggccaaccggcacaccggctcgatcgagacatacaccagggggcggcgcttcgttcac
gtcgacatcgagccgacgcagatcggccgcgtgttcgagccggattatggcatcgtgtcg
gatgccggcgcggctctcgatctgttcctttccctggcggcggagcggcgcgcggcagga
cggctgcccgacaggcgcgggtggtcagaagcctgccgcgcccgcaagcgcacgatgctg
cggcgaacccatttcgatgccgcacccataaagccacagcgcgtctacgaggaaatgaac
aaggcgttcgggcgcgaaacccgctatgtcagcacgatcgggctgtcgcagatcgcggcg
gcgcagttcctgcacgtcttccgcgcgcgcaactggatcaattgcggccaggccggtccg
ctcggctggaccatcccggcggcgctcggcgccgcggtggcggagccggaccggcccgtg
gtcgcgctttccggcgactatgacttccagttcctcatcgaggagctcgcggtcggcgcg
cagttcagcattccctacctgcacgtcgtcgtgaacaatgcgtatctcgggctgatccgc
caggcacagcgcgccttcgggatggattactgcgtcgatctcgccttcgagaacatcaac
gcgccggaacagggcccggcggcggccagcggcgtcgatcatgtcgccgtcgcggaaggt
ctcggctgcaaggcgctgcgggtgaccgagcccgacggtatcgcgcccgccctgatccgc
gccgcggcgatgatgaaggcgcatcgcgtgcccgtggtcgtcgagatcgtgctcgaacgg
gtgacgaatatcgccatgggccctgaaatcgattcgattcaggaacatgacgaacttgcc
gaacacaaggacgatgcgccaaccgcgctcgcgtttctggactga

DBGET integrated database retrieval system