KEGG   Acidiphilium multivorum: ACMV_07430Help
Entry
ACMV_07430        CDS       T01446                                 

Gene name
xdhC
Definition
(GenBank) xanthine dehydrogenase accessory protein
  KO
K07402  xanthine dehydrogenase accessory factor
Organism
amv  Acidiphilium multivorum
Brite
KEGG Orthology (KO) [BR:amv00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    ACMV_07430 (xdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XdhC_C XdhC_CoxI His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAJ80090
NITE: ACMV_07430
UniProt: F0J4N8
Position
842705..843577
Genome map
AA seq 290 aa AA seqDB search
MSTVAQPPRGVIVELRRVRGSAPREQGTRMMVTAHATDGTIGGGALEHAAIARAGALLGE
WIAHPDLAREMHELHALGPQLGQCCGGSVTLAYAPSDSGKLEAPPPMFHLQLHGAGHVGR
AVVAVLATLGCTIDWIDSRLDAFPASLPGGKAQLACRRLADPVAAIADAPPGAAFLIMTH
AHPLDAALCAAVMRRGDFGYLGLIGSETKRARFTRQWRRQDIPPAAIARLCCPIGIPAIQ
GKQPELIALAVAAELASRFPARHMRQLPRIPIDLDAECSACRASARCAGS
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaccgttgcacaacctccacgcggcgtgatcgtcgagctgcggcgcgttcgtggc
tcggcgccccgcgagcagggcacgcgcatgatggtgacggcgcacgcgaccgacggcacg
atcggtggcggcgccctggaacacgcggcgatcgcgcgcgccggcgcgctgctcggcgaa
tggatcgcccatcccgatcttgcccgcgaaatgcacgagcttcacgcgctcggcccgcag
cttggccagtgctgcggaggctccgtcaccctcgcctatgcgccgtcggactcgggaaag
ctcgaagccccgccgcccatgtttcatctgcaactgcacggggccggtcatgtcggccgt
gccgtggtcgcggttctcgcgactctcggctgcacgatcgactggatcgactcccgcctc
gacgcatttcccgccagcctccccggtggcaaggcacaactcgcctgccgcaggctggcc
gatccggtcgccgccatcgcggatgcgccgccgggtgccgcgttcctgatcatgacccat
gcccacccgctagacgcggcactgtgcgccgcggtcatgcggcgcggcgatttcggctat
ctcggcctgatcggttcggaaaccaagcgcgcgcgcttcacccgccagtggcgccggcag
gacatcccgcccgcggcgatcgcgcgcctgtgctgcccgatcgggattcccgcgatccag
ggcaagcagccggaactcatcgctctcgccgtcgccgcggaactggcatcgcggtttccg
gcgcggcacatgcgccagcttccgcgcatcccgatcgatctcgacgccgagtgcagcgcc
tgtcgtgcctcggcgcgctgcgccggatcataa

DBGET integrated database retrieval system