KEGG   Acidiphilium multivorum: ACMV_07450Help
Entry
ACMV_07450        CDS       T01446                                 

Definition
(GenBank) hypothetical protein
Organism
amv  Acidiphilium multivorum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Urate_ox_N Cytochrome_CBB3 Haem_bd
Motif
Other DBs
NCBI-ProteinID: BAJ80092
NITE: ACMV_07450
UniProt: F0J4P0
Position
844022..845221
Genome map
AA seq 399 aa AA seqDB search
MTAYMAQWAMALLIWLHVIAAIAWIGESFYFVMLDNGLKSPAEAEARERGVFGEMWSVHG
GGFYHAQKYLVSPARMPEDLHWSKWKSYTTWLSGFALFTVMYLLQPGIYLLDPSVARIAP
GLGVAAALGFLLVGWVVYDVLCRAFGDRDLRLGVAIAVYVGAAAFISTHLFAPQAAFLII
GAMLGTIMTANVFFWIIPGQKKMVAALARGETPDPLPGKRGKQRSVHNTYFTLPVVFAML
SSHFGMLFSHPASWIYLWLVMVAGALIRQFFVLWHKGQRNFALPVAGAVLIVLVIVAVAP
GAMSTGASAEAAGVQGNVTVARIEPIIHERCAACHSAHPTLMASAPNGIMFDTAAEIRSR
ASLIEQQAVSAKSMPPGNVTHITRREREEIAAWVRGGAK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgacggcctatatggcgcaatgggcgatggccctgctgatctggctccacgtgatcgcg
gcgatcgcctggatcggcgaatccttctacttcgtcatgctcgacaatgggctgaagtca
ccggccgaggccgaggcccgcgaacgcggcgtgttcggcgagatgtggtcggtccatggc
ggcgggttctaccacgcgcagaaatatctcgtctcgcccgcgcgcatgcccgaagacctg
cattggtcgaaatggaaatcctacacgacctggctgtccggcttcgcgctgttcacggtg
atgtatctgctccagcccggcatctatctgctcgatccctcggtggcgcggatcgcgccg
ggcctcggcgtggcggcggcgctcggcttcctgctcgtcggctgggttgtctatgatgtc
ctgtgccgcgccttcggcgaccgggatctgcggctcggcgtcgccattgcggtctatgtc
ggcgccgccgccttcatctcgacgcatctgttcgcgccccaggccgcgttcctgatcatc
ggcgccatgcttggcacgatcatgacggcgaatgtcttcttctggatcatcccgggccag
aaaaagatggtcgcggcgctcgcccgcggcgaaacgcccgacccgctgcccggcaagcgc
ggcaagcagcgttcggtgcacaacacctatttcacgctgccggtcgtcttcgccatgctc
agcagccatttcggcatgctgttcagccatccggccagctggatctatctctggctggtc
atggtggcgggcgcgctcattcgccagttcttcgtgctctggcacaaggggcagcgcaat
ttcgccctgccggtcgccggcgcggtgctgatcgtcctggtgatcgtcgccgtggcgccg
ggcgcgatgtcgaccggcgcgtcggccgaagccgcgggagtgcagggcaatgtaaccgtc
gcccggatcgagccgatcatccatgagcgttgcgcggcctgtcattccgcccatccgacg
ctgatggccagcgccccgaacggcatcatgttcgacacggcggccgagattcgctccagg
gcgtcgctgatcgaacagcaggcggtgagcgcgaagtcgatgccgcccggcaacgtcacg
cacatcaccaggcgggagcgagaggaaatcgccgcctgggtgaggggaggtgccaaatga

DBGET integrated database retrieval system