KEGG   Acidiphilium multivorum: ACMV_07510Help
Entry
ACMV_07510        CDS       T01446                                 

Definition
(GenBank) AraC family transcriptional regulator
Organism
amv  Acidiphilium multivorum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI HTH_18 HTH_AraC
Motif
Other DBs
NCBI-ProteinID: BAJ80098
NITE: ACMV_07510
UniProt: F0J4P6
Position
850759..851739
Genome map
AA seq 326 aa AA seqDB search
MNDRGIRTILVLAMPGVQLLDVSGPLDVFAEASAQAGRTAYRLEIAGIAPGPIVSSSGAR
LMSDRIVGDGMTGGKIDTLLVAGCPKMPDTAPPQPVLDWLRREARRARRYGSVCSGAFLL
AQAGLLDGKRATTHWAVAARLAAAFPAVTLETDAIHVRDGKLRTAAGVTAGLDLALALVE
EDLGREIAKRVAAQLVMFFKRSGGQLQFSRSGESLPSGRAMLQEVQRYVAANPAADLDVS
SLAARTGLSARHFARLFRSETGMTPASWVESARVTAAREMLESGAAAPKQVAARCGFANV
DTLRRSFQRHVGVTPAAYRRHFGGRA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatcgtgggataaggacgatcctggtgctggcgatgccgggcgtgcagttgctc
gacgtctccggaccgctcgacgtcttcgcggaggcaagcgcccaggccgggcggacagcg
tatcggctggagatcgccgggatcgcgccgggccccatcgtcagttcgtcgggcgcgcgc
ctgatgtcggaccgcatcgtcggcgacggcatgacaggcggcaagatcgacacgctgctg
gtcgcgggctgtcccaaaatgcccgacacggcgccgccgcagccggtgctggactggctg
cggcgggaagcgcggcgggcgcggcgctacgggtcggtctgcagcggcgcctttctgctt
gcccaggccggcctgctcgacggcaagcgggcaaccacgcattgggcggtggcggcgcgg
ctcgcggcggcgttccccgcagtcacgctggagaccgatgcgatccatgtgcgcgacggc
aagctgcgcaccgccgccggcgtcaccgccgggctcgatctcgccctcgctctggtcgag
gaggatctcggccgcgagatcgccaagcgggtcgccgcgcaactggtgatgttcttcaag
cggtcgggcgggcagttgcagttcagccgcagcggggagtcgctgccctccggtcgcgcc
atgttgcaggaggtgcagcgatatgtcgcggcaaatcccgccgccgatctcgatgtcagc
agtcttgccgcccgtaccggcctcagcgcccggcacttcgcccggctgttccgcagtgaa
accggaatgaccccggccagctgggtggaatccgcgcgcgtgacggcggcccgggagatg
ctcgaaagtggcgcggccgcgccgaagcaggtcgcggcgcggtgcgggttcgccaatgtc
gatacgctgcgccggtccttccagcgtcatgtgggtgtaacgccggcggcctaccgccgg
cactttggcggaagggcgtaa

DBGET integrated database retrieval system