KEGG   Acidiphilium multivorum: ACMV_07570Help
Entry
ACMV_07570        CDS       T01446                                 

Definition
(GenBank) putative ABC transporter permease protein
  KO
K10440  ribose transport system permease protein
Organism
amv  Acidiphilium multivorum
Pathway
amv02010  ABC transporters
Module
amv_M00212  Ribose transport system
Brite
KEGG Orthology (KO) [BR:amv00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    ACMV_07570
Transporters [BR:amv02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Ribose transporter [MD:M00212] [OT]
    ACMV_07570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2 Tim17 E1-E2_ATPase
Motif
Other DBs
NCBI-ProteinID: BAJ80104
NITE: ACMV_07570
UniProt: F0J4Q2
Position
857708..858712
Genome map
AA seq 334 aa AA seqDB search
MKPPEAARPAAPRRRGRIEKHLGPVSCAIGLAVVIGLYALRQPLILSPFGLASLANVSVP
LALAAIGQTIVLLGAGLDLSIGAEITLVNCFAATTMQGSPLGIGGIVVLSLLIGLGLGAV
NGLIIAYGRVEPLIATFCTSFIYGGAALIILPRPGGAIPAGFANALTGNWGILPFSLVLL
AAAVLLAWIPVFRSRLGRFIVAVGDDAESARVSGLPVRRVEMTSYVLAGLFAAIAALFLA
AETTSGDPTIGSIYTLNSLAAAVLGGVALTGGRGTAIGPILGSFLLSIILNALGVFNVSA
FWQDCIEGLILMVVLGLGGLRLLRGGNWLTVLRQ
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgcctgaagccgcgcgccccgccgccccccgccggcgcggacggatcgagaag
catctggggccggtgtcctgcgccatcggccttgccgtggtgatcggcctctatgcgctc
cgccagccgctgatcctctcgccctttggcctcgccagcctcgccaacgtctcggtgccg
cttgcccttgccgcgatcggccagaccatcgtgctgctcggcgcgggcctcgatctgtcg
atcggcgccgagatcaccctggtcaactgcttcgcggcgacgacgatgcagggcagcccg
ctcggcatcggcggcatcgtcgtgctgtcgctgctgatcggcctcgggctcggcgcggtg
aacggcctgatcatcgcctacgggcgcgtggaaccgctgatcgccaccttctgcacctcg
ttcatctatggcggcgcggcgctgatcatcctgccgcgccccggcggcgccatccccgcc
ggcttcgccaacgcgctgaccggaaactggggcattttgccgttctcgctggtgttgctg
gccgccgccgtgctgctggcctggattcccgtcttccgctcccgcctcggccggttcatc
gtcgcggtcggcgatgacgccgaaagcgcgcgcgtctccggcctgccggtgcgccgcgtc
gaaatgaccagctatgtgctggccggactgttcgccgcgatcgccgccctgttcctcgcc
gccgagaccacatccggcgatcccacgatcggcagcatctacacgctcaactcgctcgcc
gccgcggtgctcggcggcgtcgcgctgaccggcgggcgcggcacggccatcgggccgatc
ctcggcagtttcctgctctcgatcatcctcaacgccctcggcgtcttcaacgtctccgcc
ttctggcaggattgcatcgaaggattgatcctcatggtggtgctcggcctcggcgggctg
cgcctgctgcgcggcggcaactggctcacggtgctgcgccagtga

DBGET integrated database retrieval system