KEGG   Acidiphilium multivorum: ACMV_07580Help
Entry
ACMV_07580        CDS       T01446                                 

Definition
(GenBank) putative ABC transporter permease protein
  KO
K10440  ribose transport system permease protein
Organism
amv  Acidiphilium multivorum
Pathway
amv02010  ABC transporters
Module
amv_M00212  Ribose transport system
Brite
KEGG Orthology (KO) [BR:amv00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ACMV_07580
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:amv02000]
    ACMV_07580
Transporters [BR:amv02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Ribose transporter [MD:M00212] [OT]
    ACMV_07580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2 DUF656
Motif
Other DBs
NCBI-ProteinID: BAJ80105
NITE: ACMV_07580
UniProt: F0J4Q3
Position
858709..859695
Genome map
AA seq 328 aa AA seqDB search
MTAPGKTARIGTGPAPFAARLGPAARRMLLSYLILLLVYGCAVAVNPEFLGWGTIRLQLV
QATFIGLIAIGETFAILIGQIDLSVPWTITLSAILSTNLAAVYGHQWIAFAIVIAVGVAV
GLLNTLGVFVLRVHSLIWTLSVNLLLQGIALVYTNAVAPTTHIPGAARALALGNVGFMPA
AFLVWIVCGATSILALRAMPFGRSIYAIGNSPAAALLSGVPIGRVTALIFVISATCAAFV
GLLLSGYSSQAYLGMGNDYLLPPIAAVVIGGTRLSGGEGGYAGSIAGALTVVLLQAILVT
LNISEGARQLVFGAILLALALLFLKRRS
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
gtgacggcgcccggcaagacggcgcgcatcgggacaggcccggcgccgttcgccgcccgc
ctcgggccggcggcgcggcgcatgctgctgtcctacctgatcctccttctcgtttatggc
tgcgccgtcgcggtgaatcccgaattcctcggctggggcaccatacggctgcaactcgtg
caggcgacgttcatcggcctgatcgcgatcggcgagaccttcgccatcctgatcggccag
atcgacctttcggtgccgtggaccatcaccctctcggccatcctgagcaccaatctcgcg
gcggtgtacggccatcagtggatcgccttcgccatcgtcatcgcggtcggcgtcgcggtg
gggctgctgaacacgctcggcgtgttcgtgctgcgggtgcattcgctgatctggacgctc
agcgtcaacctgctgctccagggcatcgccctcgtctacacgaacgccgtcgcgccgacg
acccatatccccggcgccgcccgcgcgctcgcgctcggcaatgtggggttcatgccggcg
gcgttcctcgtctggatcgtctgcggcgcgacttccatcctggccctgcgggcgatgccg
ttcggccgctcgatctatgcgatcggcaacagcccggcggcagccctgctctccggcgtg
ccgatcggacgggtgacggcactgatcttcgtcatcagcgcgacatgcgccgccttcgtc
gggctgctgctgagcggatattcgtcgcaggcctatctcggcatgggcaacgactatctg
ctcccgccgatcgccgccgtcgtcatcggcggcacccggctgtcaggcggcgaggggggc
tatgccggcagcatcgccggcgcgctgaccgtcgtcctgctgcaggcgatcctggtgacg
ctgaacatttccgaaggcgcgcgccagctcgtcttcggcgccatcctgctggcgctggca
ttgctgttcctcaagcggcggtcatag

DBGET integrated database retrieval system