KEGG   Acidiphilium multivorum: ACMV_07600Help
Entry
ACMV_07600        CDS       T01446                                 

Definition
(GenBank) putative amino acid ABC transporter permease protein
  KO
K02029  polar amino acid transport system permease protein
Organism
amv  Acidiphilium multivorum
Module
amv_M00236  Putative polar amino acid transport system
Brite
KEGG Orthology (KO) [BR:amv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:amv02000]
    ACMV_07600
Transporters [BR:amv02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    ACMV_07600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: BAJ80107
NITE: ACMV_07600
UniProt: F0J4Q5
Position
complement(860506..861258)
Genome map
AA seq 250 aa AA seqDB search
MHFDWPYFWHQLLEPNGAFLEGLWLTIMISVGGQAIGLAIGLPAALARRSKMGVLRWPAR
AYIFLMRGTPLLVQIVFIYTGLAAAGILRFHDIHLGGLTLAGNVQAGILALGLNEGAYMA
EIFRAGIDAVDRGQTEAAKSLGMVPWQILRYVVLPQALRVVLLPIGNQFNIMLKNSTLVS
VIGVSEMLLVTETINSATFRTFELYSVLALYFLALTTIWGAVMAQVERRMDRQPDDSAID
AISQPMTETA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtgcatttcgactggccttatttctggcatcagctgctggagccgaacggcgccttcctt
gaggggctctggctgacgatcatgatcagcgtcggggggcaggcgatcgggctcgcgatc
ggtctgcccgcagcgctcgcaaggcggtcgaagatgggcgtcctgcgttggccggcgcgg
gcctatatcttcctgatgcgcggcacgcctctgctggtgcagatcgtcttcatctatacc
ggactcgcggccgccggcattctccggttccatgacatccatctcggcggactcaccctc
gcgggcaatgtgcaggccggcatcctcgcgctgggcctgaacgaaggggcgtacatggcc
gaaatattcagggccggcatcgatgccgtcgatcgcggccagaccgaggcggcgaaatcg
ctcggcatggttccctggcagatccttcgatatgtcgtgctgccccaggcgctacgtgtg
gttttgttgccgatcggcaatcagttcaacatcatgctgaagaactcgacgctggtgagc
gtgatcggcgtttcggaaatgctgctggtcaccgagacgatcaattcggccacgttccgc
accttcgaactctactcggtgcttgccctctattttctcgcgttgaccacgatatggggt
gccgtgatggcgcaggtcgagcgccggatggacaggcagcccgacgacagcgccatcgac
gccatcagccagccgatgacggaaaccgcctga

DBGET integrated database retrieval system