KEGG   Acidiphilium multivorum: ACMV_09150Help
Entry
ACMV_09150        CDS       T01446                                 

Gene name
metG
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
amv  Acidiphilium multivorum
Pathway
amv00450  Selenocompound metabolism
amv00970  Aminoacyl-tRNA biosynthesis
amv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ACMV_09150 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ACMV_09150 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:amv01007]
    ACMV_09150 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:amv03016]
    ACMV_09150 (metG)
Enzymes [BR:amv01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     ACMV_09150 (metG)
Amino acid related enzymes [BR:amv01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   ACMV_09150 (metG)
Transfer RNA biogenesis [BR:amv03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ACMV_09150 (metG)
 Prokaryotic type
   Other AARSs
    ACMV_09150 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-ProteinID: BAJ80262
NITE: ACMV_09150
UniProt: F0J5L3
Position
complement(1046120..1047655)
Genome map
AA seq 511 aa AA seqDB search
MTRKFYITTPIYYVNGAPHIGHAYTSVAADVLARFKRLDGFDVHFLTGTDEHGQKVEATA
RANNIAPQEFTDRIAGEFRAMAQAMNISNDDFIRTTEPRHIRSCQAIWQAIERAGAIELG
HYEGWYAVRDEAFYDESELVTGADGIKRSPFGAPVEWVREPSYFFKLSTFQDRLLKLYED
NPEFIQPASSRNEVLSFVRSGLRDISISRTSFKWGIPVPGAPDHVMYVWIDALTNYLTAC
GYPDMDAPLMKYWPADLHLVGKEITRFHAVYWPAMLMAAGLPVPRRIFANGWWTIEGEKM
SKSLNNALAVEPLIAEFGLDQLRFCLLREMPFGNDGNFSRRSVITRINVELANDLGNLAQ
RTLSFIAKNAGGVVPEAGPAAEADHALRAIADGLPDRMRDAMDRLAYQEAIEEVWKLVRA
ANAYIDHQAPWALRKTDPQRMLTVLRTLCEALRVVGILLQPFMPEAMAKLLDQLALPADR
RGFASLATPLDAGAVLPPPSGLFPRIVEPAS
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgacccgaaaattctacatcacgaccccgatctattacgtgaacggcgcgccccatatc
ggccacgcctacacctcggtcgccgccgacgtgctcgcgcgcttcaagcggctcgacggg
ttcgacgtgcatttcctcaccggcaccgacgagcatggccagaaggtcgaggccaccgcc
cgcgcgaacaacatcgccccgcaagagttcaccgaccgcatcgccggcgagttccgcgcc
atggcgcaggcgatgaacatctcgaacgacgatttcatccgcaccaccgagccccgccac
atccgctcctgccaggcgatctggcaggcgatcgagcgggcaggggccatcgagctcggc
cattacgagggctggtacgccgtccgcgacgaggccttctatgatgaaagcgagctcgtc
accggcgcggacggcatcaagcgctcgcccttcggcgcgccggtcgagtgggtgcgcgaa
ccctcgtatttcttcaaactcagcacgttccaggatcgtcttctgaaactgtatgaagac
aatccggagttcatccagcccgcttccagccgcaacgaggtgctctccttcgtccgctcc
ggcctgcgcgacatctcgatcagccgcaccagcttcaaatggggcattccggtgcccggc
gcgcccgatcacgtcatgtatgtctggatcgacgcgctgaccaactatctcaccgcctgc
ggctatccggacatggacgcgccgctgatgaaatactggccggcggacctgcatctggtc
ggcaaggaaatcacccgcttccacgccgtctactggccggcgatgctgatggccgccggc
ctgccggttccccgccgcatcttcgccaatggctggtggacgatcgagggcgagaagatg
agcaagtcgctcaacaacgccctggccgtcgagccgctgatcgcggaattcgggctcgac
cagctgcgcttctgcctgctgcgcgaaatgcccttcggcaacgacggcaatttctcccgc
cgttcggtcatcacgcggatcaatgtcgagctcgccaacgatctcggcaacctcgcccag
cgcacgctctccttcatcgccaagaacgctggcggcgtggtgcccgaagcgggtcccgcc
gccgaggccgatcacgcgctgcgcgccatcgccgacggcctgccggaccgcatgcgcgat
gcgatggatcgcctggcctatcaggaggcgatcgaggaggtctggaaactcgtccgcgcc
gccaacgcctatatcgaccaccaggctccctgggccttgcgcaagaccgacccgcagcgg
atgctgactgtgctgcggaccctctgcgaggcgctgcgcgtcgtcggcatcctgctgcag
cccttcatgccggaagccatggcgaaactgctggaccagcttgcccttccggcggatcgg
cggggtttcgcgtcactcgccaccccgctcgacgctggcgccgttctgccgccgccgtcc
ggcttgttcccccggatcgtcgaacccgcttcctga

DBGET integrated database retrieval system