KEGG   Acidiphilium multivorum: ACMV_10880Help
Entry
ACMV_10880        CDS       T01446                                 

Gene name
cbbS
Definition
(GenBank) ribulose bisphosphate carboxylase small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
amv  Acidiphilium multivorum
Pathway
amv00630  Glyoxylate and dicarboxylate metabolism
amv00710  Carbon fixation in photosynthetic organisms
amv01100  Metabolic pathways
amv01110  Biosynthesis of secondary metabolites
amv01120  Microbial metabolism in diverse environments
amv01130  Biosynthesis of antibiotics
amv01200  Carbon metabolism
Module
amv_M00165  Reductive pentose phosphate cycle (Calvin cycle)
amv_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
amv_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:amv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ACMV_10880 (cbbS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    ACMV_10880 (cbbS)
Enzymes [BR:amv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     ACMV_10880 (cbbS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: BAJ80435
NITE: ACMV_10880
UniProt: F0IX25
Position
complement(1230466..1230894)
Genome map
AA seq 142 aa AA seqDB search
MRLTQGCFSFLPDLTDEQISRQIQYCLDKGWAVNLEYTDDPHPRNTYWEMWGLPMFDIRD
AKAIMSELADCRRIHDDCYIRLSAFDATNTWESLRISFIVQRPKDEPGFMLTRSEAAGRT
MRYETRAYVVQKPEGARYGNSG
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgagactgacccagggctgcttttcgtttcttcccgatctgaccgatgaacagatcagc
cgccagatccagtactgcctcgacaagggctgggcggtgaacctcgaatataccgacgac
ccgcacccgcggaatacctactgggaaatgtggggcctgccgatgttcgacatccgcgat
gccaaggcgatcatgtccgaactcgcggactgccggcggattcacgatgattgctatatc
cgcctctcggcgttcgacgccaccaacacatgggagtcgctccgcatttccttcatcgtg
cagcggccgaaggacgaacccggcttcatgctgacacggagcgaggccgccggccgcacc
atgcgctacgaaacccgcgcctatgtcgtccagaaacccgaaggcgcgcgctatggaaat
tccgggtga

DBGET integrated database retrieval system