KEGG   Acidiphilium multivorum: ACMV_10900Help
Entry
ACMV_10900        CDS       T01446                                 

Gene name
cbbA
Definition
(GenBank) fructose-bisphosphate aldolase class II
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
amv  Acidiphilium multivorum
Pathway
amv00010  Glycolysis / Gluconeogenesis
amv00030  Pentose phosphate pathway
amv00051  Fructose and mannose metabolism
amv00680  Methane metabolism
amv00710  Carbon fixation in photosynthetic organisms
amv01100  Metabolic pathways
amv01110  Biosynthesis of secondary metabolites
amv01120  Microbial metabolism in diverse environments
amv01130  Biosynthesis of antibiotics
amv01200  Carbon metabolism
amv01230  Biosynthesis of amino acids
Module
amv_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
amv_M00165  Reductive pentose phosphate cycle (Calvin cycle)
amv_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
amv_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:amv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACMV_10900 (cbbA)
   00030 Pentose phosphate pathway
    ACMV_10900 (cbbA)
   00051 Fructose and mannose metabolism
    ACMV_10900 (cbbA)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    ACMV_10900 (cbbA)
   00680 Methane metabolism
    ACMV_10900 (cbbA)
Enzymes [BR:amv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     ACMV_10900 (cbbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase
Motif
Other DBs
NCBI-ProteinID: BAJ80437
NITE: ACMV_10900
UniProt: F0IX27
Position
complement(1232415..1233494)
Genome map
AA seq 359 aa AA seqDB search
MARITLRQLLDHAAERGYGVPAFNINNMEQVIAIMEAAASCDAPVILQASRGARSYAGDR
MLAKMIEAAEAEHPQIPICLHQDHGNDEATCLSAIQHGFTSVMMDGSLMADARTPADYDY
NVAITARVTDMAHRVGVSVEGELGVLGSLETGTGAAEDGHGAEGTLSHDQLLTDPDQAVA
FVRATKVDALAVAMGTSHGAYKFSRKPDGAILAMHVIRAINERMPELHLVMHGSSSVPQD
LQEAFNRHGGEMPQTWGVPVEEILLGIRHGVRKVNIDTDCRLAMAAAIRKVATGNRAEFD
PRQFMKPAIAALRDLCRSRFQAFGTAGQASRIKPQPLAAMARQYASGALDPVIDVGRAA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcataacattgcgtcagctactcgatcatgcggcggaacgcggatatggcgtt
cccgccttcaacatcaacaacatggaacaggtgatcgcgatcatggaggccgccgcgtcc
tgcgatgcgccggtcatcctccaggcctcgcgcggcgcccggtcctatgccggcgaccgg
atgctggcgaagatgatcgaggcggcggaggccgagcacccgcagattcccatctgcctg
caccaggaccacggcaacgacgaggcgacctgcctgtcggcgatccagcacgggttcacc
agcgtgatgatggacggctcgctgatggccgacgcaagaacccccgccgactacgactac
aatgtcgccatcaccgcccgcgtcaccgacatggcgcatcgcgtcggcgtttcggtcgag
ggcgagctcggcgtgctcggcagtctcgaaaccggcaccggtgcggccgaggacggtcac
ggcgccgagggcacgctctcccacgaccagctcctgaccgaccccgaccaggcggttgcc
ttcgtgcgtgccacgaaggtcgacgcgctggcggtcgccatgggaacctcccacggcgcc
tacaagttttcccgcaagccggatggcgcgattctcgcgatgcacgtcatccgcgccatc
aacgagcgcatgcccgaactccatctcgtcatgcacggctcgtcctcggtcccgcaggac
ctgcaggaggccttcaaccgccacggcggcgagatgccgcagacctggggcgtgcccgtc
gaggaaatcctcctcggcattcgtcacggcgtgcgcaaggtgaatatcgacaccgattgc
cgcctcgccatggccgccgccatccgcaaggtcgccaccgggaaccgcgcggaattcgac
ccccgccagttcatgaagcccgccatcgcggcactgcgcgatctctgccgctcgcgcttc
caggccttcggcaccgccgggcaggcctcgcgaatcaaaccgcagcccctcgccgcgatg
gccaggcaatacgcatccggcgccctcgatcccgtgatcgatgtcggccgcgccgcttga

DBGET integrated database retrieval system