KEGG   Acidiphilium multivorum: ACMV_18130Help
Entry
ACMV_18130        CDS       T01446                                 

Definition
(GenBank) cysteine desulfurase
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
amv  Acidiphilium multivorum
Pathway
amv00730  Thiamine metabolism
amv01100  Metabolic pathways
amv04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:amv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    ACMV_18130
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    ACMV_18130
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:amv03016]
    ACMV_18130
   03029 Mitochondrial biogenesis [BR:amv03029]
    ACMV_18130
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:amv02048]
    ACMV_18130
Enzymes [BR:amv01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     ACMV_18130
Transfer RNA biogenesis [BR:amv03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    ACMV_18130
 Prokaryotic Type
    ACMV_18130
Mitochondrial biogenesis [BR:amv03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    ACMV_18130
Prokaryotic defense system [BR:amv02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   ACMV_18130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Beta_elim_lyase AAA_lid_6 Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: BAJ81160
NITE: ACMV_18130
UniProt: F0IZF0
Position
complement(2022000..2023202)
Genome map
AA seq 400 aa AA seqDB search
MPNGANRIVPGRAKPTMTSPLPGAEPGLYLDANATEALRPEAREAVLAAFDLVGNPASVH
ADGRAARKLLESARAALAARLGARPENVVFCAGATEANAMAIHGLAGGGAIVIGATEHDA
VRAAAPAALIAPVDAAGRLDQTAFAALLAAHRPALACVMAANNETGVLNDIAAIAALCAA
QGTRLHVDAVQAAGRVADPDYLAQGASSVATSAHKLGGPKGVGALLLAPEAASAFAPLIR
GGGQERGRRGGTHNLPGIAGFAAALDAAHATTCPDPRLAALRDAIEAGARDCGARIAGAG
APRLPNTTCLVLPGLAAEAQVIALDLDGIRVSAGSACSSGKAASSHVLAAMGLGDLAGNA
IRVSLPWNAPDDAPARFLAAYRRLAARALRKSAHVSTSAA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgccgaacggcgcgaaccggatcgtgccgggccgcgcgaaaccgaccatgacgagcccg
ttgcccggggctgagccgggcctctacctcgacgccaacgcgaccgaggcgctgcgcccc
gaagcccgcgaggcggtgctcgccgccttcgatctcgtcggcaatccggcctccgtccac
gccgatggcagggccgcgcgcaagctgctcgaatccgcccgcgccgcccttgccgcacgc
ctcggcgcccggccggaaaacgtcgtcttctgcgcgggcgcgaccgaggcgaacgcgatg
gcgatccatggcctcgccggcggcggcgccatcgtgatcggcgccaccgagcacgatgcc
gtgcgcgccgccgcccccgccgccctcatcgccccggtcgatgccgccggccggctcgac
cagaccgccttcgccgccctgctggccgcgcaccgcccggcactcgcctgcgtcatggcg
gcgaacaacgaaaccggcgttctcaacgacatcgccgccatcgccgccctctgcgccgcg
cagggcacgcgcctgcatgtcgatgccgtgcaggccgccggccgcgtcgccgatcccgat
tatctcgcccagggggcgtccagcgtcgcgacctccgcgcacaagctcggcggcccgaaa
ggggtgggcgccctgctgctcgcacccgaggccgcgtccgccttcgcgccgctgatccgc
ggcggcgggcaggagcgcggccgccgcggcggcacccacaacctgcccggcatcgccggc
ttcgccgccgccctcgacgccgcccacgcaaccacatgccccgatccgcgcctcgccgcc
ctgcgcgatgcgatcgaggccggcgcgcgcgactgcggcgcccgcatcgccggcgccggg
gccccgcgtttgccgaacacgacctgcctcgtcctgcccggccttgccgccgaagcccag
gtcatcgcgctcgatctcgacggcatccgcgtctccgccggctcggcctgctcctccggc
aaggccgccagcagccacgttctcgccgccatgggcctcggcgatctcgctggcaacgcc
atccgcgtctcgttgccctggaacgcgccggacgacgcgcccgcccgtttcctcgccgca
tatcggcgtcttgccgcccgcgccttgcgcaaatccgcgcatgtctctacctcggcagcg
tga

DBGET integrated database retrieval system