KEGG   Acidiphilium multivorum: ACMV_18890Help
Entry
ACMV_18890        CDS       T01446                                 

Gene name
bchI
Definition
(GenBank) magnesium-chelatase 38 kDa subunit
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
amv  Acidiphilium multivorum
Pathway
amv00860  Porphyrin and chlorophyll metabolism
amv01100  Metabolic pathways
amv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ACMV_18890 (bchI)
Enzymes [BR:amv01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     ACMV_18890 (bchI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 AAA_22 MCM DUF815 Sigma54_activat AAA_16 AAA AAA_29
Motif
Other DBs
NCBI-ProteinID: BAJ81236
NITE: ACMV_18890
UniProt: F0IZM6
Position
complement(2109145..2110167)
Genome map
AA seq 340 aa AA seqDB search
MGPYPFSAIVGQAEMKEALLIAAIEPALGGVLALGDRGTGKSTAVRALAALLPAVSAVAG
CRYRCDPADRRRLCPECRARRVGGRLPRERVRVPVVDLPLGATEDRVVGALDIERALADG
VKAFEPGLLARANRGFLYIDEINLLEDHLVDLLLDVAASGENVVEREGLSLRHPARFVLI
GSGNPEEGELRPQLLDRFGLCVEVRTPTDIGERIEVVRRRDAFEQDPAGFARRFAAAEAG
LREAIVAARRLLPMVAVADEVLALAARLCVALGTDGLRGELTLLRAARAKAALEGEIAVT
PAHLRAVAPAALRHRLRRDPLDESMAGARVDRALDEVFVA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgggcccgtatccgttcagcgcgatcgtcggccaggcggagatgaaggaggcgctgctg
atcgcggcgatcgagccggcgctcggcggggtgctggcgctgggcgatcgcggcaccggc
aagtcgaccgcggtgcgggcgctggcggcgttgctgccggcggtgagtgcggtggcgggc
tgccgctatcgctgcgatccggccgatcggcggcggctctgcccggagtgccgggcgcgt
cgcgtcggcgggcggttgccgcgcgagcgggtgcgggtgccggtggtcgacctgccgctc
ggcgccaccgaggacagggtggtcggcgcgctggacatcgagcgcgcgctcgccgacggg
gtcaaggccttcgagccggggctgctggcccgcgccaatcgcggctttctctatatcgac
gagatcaatctgctggaggatcatctggtggatctgctgctcgatgtcgcggcgtcgggc
gagaacgtggtcgagcgcgaggggctgagcctgcgccacccggcgcgcttcgtgctgatc
ggcagcggcaaccccgaggagggcgagttgcggccgcaactgctcgaccggttcgggctg
tgcgtcgaggtcaggacgccgacggatatcggcgagcggatcgaggtggtgcggcggcgc
gatgcgttcgagcaggacccggccggcttcgcgcggcgcttcgcggcggcggaggccggg
ctgcgcgaggcgatcgtcgcggcgcggcggttgctgccgatggtcgcggtcgccgacgag
gtgctggcgctcgccgcccggctgtgcgtggcgctcggcaccgacgggctgcgcggcgag
ttgacgctgctgcgcgcggcaagggcgaaggcggcgctggaaggcgagatcgcggtgacg
ccggcgcatctgcgggcggtggccccggcggcgctgcgccaccggctgcggcgcgatccg
ctcgatgaatcgatggccggcgcgcgggtcgatcgcgcgctcgacgaggtgttcgtcgca
tga

DBGET integrated database retrieval system