KEGG   Acidiphilium multivorum: ACMV_18990Help
Entry
ACMV_18990        CDS       T01446                                 

Gene name
bchL
Definition
(GenBank) light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
amv  Acidiphilium multivorum
Pathway
amv00860  Porphyrin and chlorophyll metabolism
amv01100  Metabolic pathways
amv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ACMV_18990 (bchL)
Enzymes [BR:amv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     ACMV_18990 (bchL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA SRP54 MeaB AAA_26 AAA_24 AAA_25 AAA_16 MipZ AAA_10 NB-ARC
Motif
Other DBs
NCBI-ProteinID: BAJ81246
NITE: ACMV_18990
UniProt: F0IZN6
Position
2122580..2123503
Genome map
AA seq 307 aa AA seqDB search
MNDISPQAGAFPAAARCATGCGDGEGSVQVALDPALRIDGAKVFAIYGKGGIGKSTTSSN
LSAAFALQGRRVLQIGCDPKHDSTFTLTKRLVPTVIDALEGVDFHPEELRVEDFVYEGFA
GVQCVEAGGPPAGTGCGGYVVGQTVKLLKEHHLLEESDVVIFDVLGDVVCGGFAAPLQHA
DRALIVTANDFDSIFAMNRIVAAIGAKARNYGVRLGGVIANRSAAVDQLAKYNEATGLST
LARFPDLDAIRRSRLRKSVVFEMEDAPELDAVRTAYLDLAASLWAGVEPLAAVPLRDREI
FDLLGFE
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacatcagcccccaagccggcgcgtttcccgcagccgcgcgctgcgccaccggc
tgcggcgacggcgagggcagcgtgcaggtcgccctcgatcccgcgctgcggatcgacggg
gcgaaggtcttcgccatctacggcaagggcggcatcggcaagagtacgacctcctcgaac
ctctccgccgccttcgccctgcaaggccgccgtgtgctgcagatcggctgcgaccccaag
cacgattccaccttcaccctgaccaagcgtctcgtccccaccgtgatcgacgcgctggaa
ggtgtcgatttccaccccgaggaactccgcgtcgaggatttcgtctacgagggcttcgcc
ggcgtgcaatgcgtcgaggccggcggcccgccggccggcaccggctgcggcggctacgtc
gtcgggcagacggtgaagctgctcaaggaacatcatctcctcgaggagtcggacgtcgtc
atcttcgacgtgctgggcgatgtcgtctgcggcggtttcgccgccccgctgcaacacgcc
gaccgcgcgctgatcgtcacggcgaacgatttcgacagcatcttcgcgatgaaccgcatc
gtcgccgcgatcggcgcgaaggcgcgcaactacggcgtgcggctcggcggcgtcatcgcc
aaccgcagcgccgcggtcgaccagctcgcgaaatacaacgaggccaccggcctctccacc
ctcgcccggttccccgatctcgacgccatccgccgcagccggctgaggaaatccgtcgtc
ttcgaaatggaggacgcaccggagctcgacgccgtgcgcaccgcctatctcgatctcgcc
gcgtcgctctgggccggcgtcgagccgctcgccgcggtcccgctgcgcgaccgcgagatc
ttcgacctgctgggattcgagtga

DBGET integrated database retrieval system