KEGG   Acidiphilium multivorum: ACMV_22740Help
Entry
ACMV_22740        CDS       T01446                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
amv  Acidiphilium multivorum
Pathway
amv00020  Citrate cycle (TCA cycle)
amv00480  Glutathione metabolism
amv01100  Metabolic pathways
amv01110  Biosynthesis of secondary metabolites
amv01120  Microbial metabolism in diverse environments
amv01130  Biosynthesis of antibiotics
amv01200  Carbon metabolism
amv01210  2-Oxocarboxylic acid metabolism
amv01230  Biosynthesis of amino acids
Module
amv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amv_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:amv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ACMV_22740 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ACMV_22740 (icd)
Enzymes [BR:amv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ACMV_22740 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh TT1725
Motif
Other DBs
NCBI-ProteinID: BAJ81621
NITE: ACMV_22740
UniProt: F0J0T5
Position
complement(2504330..2505793)
Genome map
AA seq 487 aa AA seqDB search
MIATSPALAKTLVTALPGDGIGPEVFEATRRIFEAAEAPVEWEVAEAGAAVFRKGIASGA
PRETLDSIARNRIALKGPLETPVGYGNKSANVTLRKHFELYANIRPVRELPGVKTPFTGR
GIDMVIVRENVEDVYAGIEHMQTPDVAQCLKLMTRPGCERIIRAAFGLAQAEDRRKLTCA
TKANIMKLTEGMMKRVFEEVGPDYPDIAQDHIIIDNCAHQLVIAPEQFDVIVTSNMNGDI
ISDLAAGLVGGLGIAPSSNLGDHAAIFEAVHGSAPAIAGKGLANPTALLSAAIMMLRHIG
AFETAETIEQALFITLAEGENLTGDLSPRGHGVGTDKFVGQVIENLGRTSNLPSRAYRPL
ELKAWPDRTAHTEPASRELLGVDIFLESSLSAAELGASLTAIAEGSALRLDSISNRGVQV
WPATGGRTFLVDHFDCRFMLNEPAAGNGPQGISDLVKAIGQKHSWMHVEKLQRFDGKDAF
ERPQGES
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcaacctcgcccgccctcgccaagacccttgtcaccgccctgccgggcgatggg
atcggccccgaagtcttcgaggcgacgcgccgcatcttcgaggccgccgaagcgccggtc
gagtgggaggttgccgaagccggcgccgccgtgttcaggaagggcatcgcctccggcgcg
ccgcgcgaaaccctcgattccatcgcgcgcaaccgcatcgccctcaaggggccgctggaa
acgccggtcggctacggcaacaagtcggccaacgtcaccctgcgcaagcatttcgagctc
tatgccaatatccgcccggtccgcgagctgcccggggtgaagacgccgttcaccgggcgc
gggatcgacatggtcatcgtccgcgagaacgtggaggacgtctatgccggcatcgagcac
atgcagactccggatgtcgcccagtgcctcaagctgatgacgcggccgggctgcgagcgc
atcatccgcgccgccttcggccttgcccaggcggaggaccgccggaagctgacctgtgcc
accaaggcgaacatcatgaagctcaccgagggcatgatgaagcgcgtcttcgaggaagtc
ggtcccgattatccggatatcgcgcaggatcacatcatcatcgataactgcgcccaccag
ctcgtcatcgcccccgagcagttcgacgtgatcgtgacctcgaacatgaatggcgacatc
atttccgatctcgccgccgggctggtcggtggcctcggcatcgcgccatcctccaatctc
ggcgatcacgcggcgattttcgaggcggtgcacggttcggcgccggccatcgccggcaag
gggctcgccaacccgaccgcgctgctgtccgccgcgatcatgatgctccgccatatcggc
gccttcgagacggccgagacgatcgagcaggcgctgttcatcaccctcgccgagggggag
aacctgaccggcgacctctcgccgcgcggccatggcgtcggcaccgacaagttcgtcggc
caggtcatcgagaatctcggccgcacgagcaatctcccgtcgcgcgcctaccggccgctc
gagctcaaggcgtggcccgaccgcaccgcccatacggagcccgcaagccgcgaactgctt
ggcgtcgacatctttctggaaagcagcctttccgcggccgagctgggcgcctccctcacc
gcgattgccgagggcagtgcgctccgcctcgactcgatctcgaatcgcggcgtccaggtc
tggccggcgaccggcggcaggaccttcctcgtcgaccatttcgattgccgcttcatgctc
aatgaacccgcggccggaaacgggccgcagggcatttccgacctcgtgaaggcgatcgga
cagaagcattcctggatgcatgtcgagaagctgcaacggttcgatggcaaggacgccttc
gaacggccccagggcgaaagctga

DBGET integrated database retrieval system