KEGG   Acidiphilium multivorum: ACMV_23360
Entry
ACMV_23360        CDS       T01446                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
amv  Acidiphilium multivorum
Brite
KEGG Orthology (KO) [BR:amv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:amv02044]
    ACMV_23360
Secretion system [BR:amv02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ACMV_23360
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: BAJ81683
NITE: ACMV_23360
UniProt: F0J1E0
Position
complement(2584835..2586166)
AA seq 443 aa
MSWTNRVVWQEGMFLRSQHFQQQDRWLEAQVRGRVAALRPYPWGISRLAVNRELLGTGRF
ALAEAEGVFEDGTCFSLPGEADHPPPFEVPENTRNMLLHLALPVRQPGAAEIAAEDGSTE
GRYGAARFEAYDTHSASPEPAELLIARLRLRYLLDSEDRAGFLCLPVARIVEVSADRRVT
LDDRWIPPALVCHAAPPLAGLIAEFSGMIHQRGEALAARLNAPGTRGVAEVQDFMLLQAI
NRWQAMLQHWADAAVIHPETLYSAFVSMAGEFATFIEGSRRPTAYPGYRHDDLQRSFAPV
VADLRRALSAVIEQNAVPIPLQERRHGVHVGPIVDRSILRAANFVLTVQADVPAETLRRL
FPAQVKIGAVEHIRELVNVALPGISVRPLPVAPRQIPFYAGATYFELDRGSPHWQQMQNS
GAFALHVSGEFPGLKLELWAIRG
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgagctggaccaacagggtcgtctggcaggaaggcatgttcctgcgctcgcagcatttc
cagcaacaggaccgttggctcgaagcccaggtgcgcggccgggtggcggcgctgcggccc
tatccgtggggaatctcccgtctcgcggtcaaccgggaactgctcggcaccggccgtttc
gccctggccgaggctgaaggcgtgttcgaggacggaacctgcttctccctgccgggcgag
gccgatcatccgccgccgttcgaggtgcccgagaacacgcgcaacatgctgcttcacctc
gcgctgccggtgcgccagcccggcgccgccgagatcgccgcggaagacggcagcaccgag
ggacgctacggcgccgcccgcttcgaggcctacgacacgcattccgcctcgcccgagccg
gcggagctgctgatcgcccggctgcgcctgcgctatctcctcgacagcgaggaccgcgcc
ggcttcctctgcctgccggtcgcgcggatcgtcgaggtttcggccgaccggcgcgtcacg
ctggatgaccgctggattccgccggcgctggtctgtcacgcggcgccgccgctcgccggg
ctgatcgccgaattctccggcatgatccaccagcgtggcgaggcgctcgccgcccggctc
aacgcgccgggcacgcgcggcgtcgccgaggtgcaggatttcatgctgctccaggcgatc
aaccgctggcaggcgatgcttcagcactgggccgacgccgccgtgatccatccggagacc
ctctattccgccttcgtctcgatggccggcgagttcgccaccttcatcgagggcagccgc
cggcccaccgcctatcccggttaccggcacgacgatctgcaacgcagcttcgcgccggtc
gtcgccgatctgcggcgggcgctctcggcggtcatcgaacagaacgccgtgccgatcccg
ctgcaggagcggcgccacggcgttcatgtcggcccgatcgtcgaccgcagcatcctgcgc
gccgcgaatttcgtcctgaccgtgcaggccgacgtgccggccgagaccctgcgccggctg
ttccccgcgcaggtgaagatcggcgccgtcgagcatatccgcgaactggtcaacgtcgcg
ctgcccggcatctcggtgcggccgctcccggtggcgccccggcagatccctttctatgcc
ggcgccacctatttcgagctcgatcgcggcagtccgcactggcagcagatgcagaattca
ggcgcgttcgcactgcacgtatcgggcgaatttccggggctgaaactcgaactctgggcg
atccgcggctga

DBGET integrated database retrieval system