KEGG   Acidiphilium multivorum: ACMV_23450Help
Entry
ACMV_23450        CDS       T01446                                 

Definition
(GenBank) cytochrome c
  KO
K08738  cytochrome c
Organism
amv  Acidiphilium multivorum
Pathway
amv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:amv00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ACMV_23450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-ProteinID: BAJ81692
NITE: ACMV_23450
UniProt: F0J1E9
Position
complement(2603316..2603687)
Genome map
AA seq 123 aa AA seqDB search
MKSTLLIAVAAGAFCIASAQAANVAHGKALFQAQCAACHSVSPGQNGIGPSLAGVYGAKA
AATPGFQFSPALKKSGIVWNASTLDKFLANPQADVPGTKMPYMGMANATDRADVVAYLQT
LGK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccactcttctcatcgccgttgccgcgggtgcattctgcatcgcgagcgcgcag
gcggcgaacgtggcacatggcaaggcactgtttcaggcccagtgcgcagcctgccatagc
gtgagcccggggcagaacgggatcggcccgtcattggcgggcgtctacggcgcgaaggcc
gctgcgaccccgggattccagttctccccggcgctcaagaagtccggaatcgtgtggaac
gcctcgacgctcgacaagttcctggccaatccgcaggcggatgtgccgggcaccaagatg
ccctatatgggcatggccaatgccaccgatcgggccgacgtggtcgcctatctgcagacg
ctcggcaaataa

DBGET integrated database retrieval system