KEGG   Acidiphilium multivorum: ACMV_24920Help
Entry
ACMV_24920        CDS       T01446                                 

Definition
(GenBank) sugar ABC transporter ATP-binding protein
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
amv  Acidiphilium multivorum
Pathway
amv02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:amv00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ACMV_24920
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:amv02000]
    ACMV_24920
Enzymes [BR:amv01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     ACMV_24920
Transporters [BR:amv02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    ACMV_24920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 Zeta_toxin RsgA_GTPase AAA_23 AAA_22
Motif
Other DBs
NCBI-ProteinID: BAJ81839
NITE: ACMV_24920
UniProt: F0J295
Position
complement(2750984..2752492)
Genome map
AA seq 502 aa AA seqDB search
MPVLETVAVSRRFGAVRALEGVSLTLNAGEVHGLAGENGAGKSTLIKLLTGFHQPDDGTI
RLGGAAVRFDSPRTAQRHGISAVYQEINLIPERDVAENLFLGHEPRRFGWLIDRRRMEAE
AQSLLARYELRIDPRARLGTLGLGLQQMVAIARGIRLGAKVVILDEPTSALTGGEVETLF
RVVDRLKAERIAILFVSHRLSECYRLCDRFSVLRDGRLVASAPAADLPRQALIAAMLGRS
AETLQRQHAPRAAASGAPALAARHLTWRNRVRDVSYEVMPGEVVGLAGLLGSGRTETMKA
SFGIETPGAGTVEVGGRPLPAPAPERSIAAGLAFLSEDRRAEGIFPKLSVAENLTACALR
RISRYGFVSRRRQAEMVAEFVRLLGIKTAGAEAPITSLSGGNQQKVLLARCLATDPRAIM
LDDPTRGIDVGAKAEVHDAIRRLVERGLGVLVTSSEMEELMVLADRLVILDEGRVADTME
TAGAGVQDVLDRLAAPHERAGA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtgccggttcttgaaacggtcgccgtttcaaggcgtttcggtgcggtgcgggcgttggag
ggggtgtcgctgacgctcaatgccggcgaggtgcatggacttgccggcgagaacggcgcc
ggcaagtcgacgctgatcaagctgctgaccgggttccatcagcctgacgacggaacgatc
aggctgggcggcgcggcggtgcggttcgactccccccgcaccgcccaacgccacggcatc
agcgccgtctaccaggagatcaacctgatccccgaacgggacgtggccgagaacctcttc
ctcggccacgagccgaggcggtttggctggctgatcgaccggcgccggatggaggcggag
gcgcagtcgctgctggcgcgctacgagttgcgcatcgacccgcgggcgcggctcggcacg
ctcgggctcgggctccagcagatggtcgcgatcgcccgcggcatccggctcggcgcgaag
gtcgtcattctcgacgagccgacctccgcgctcaccggcggcgaggtcgagaccctgttc
cgcgtggtcgaccggctgaaggccgagcgcatcgcgatcctgttcgtcagccaccggctg
tcggaatgttaccggctgtgcgaccgcttctcggtgctgcgcgacggccgcctggtcgcc
agcgcgccggccgccgacctgccgcgccaggcgctgatcgccgcgatgctggggcggagc
gcggagacgctgcagcgccagcacgcgccgcgcgcggcggcttcgggcgccccggcgctg
gccgcgcgccatctcacctggcgcaaccgggtgcgggacgtgtcctacgaggtcatgccc
ggcgaggtggtcggcctggccggcctgctcggctccggccgcaccgagacgatgaaggcg
agtttcgggatcgagacgccgggtgccggcacggtcgaggtcggcggccggccgctgccc
gcccccgcgccggagcggtcgattgccgccggcctcgccttcctgtcggaagaccggcgg
gcggaggggatctttccgaagctctcggtcgccgagaacctgacggcctgcgcgctgcgg
cgcatctcccgctacggcttcgtctcccgccgccggcaggccgaaatggtggccgagttc
gtccgcctgctggggatcaagacggcgggcgccgaagcgcccatcacctcgctttcgggc
ggcaaccagcagaaggtcctgctggcccgctgcctcgccaccgacccgcgcgccatcatg
ctcgacgacccgacgcgggggatcgatgtgggcgccaaggccgaggtgcatgacgcgatc
cgccgcctggtcgagcgcggcctcggtgtgctggtgacgtcttcggaaatggaggagctg
atggtgctggccgaccggctggtgatcctcgacgagggacgtgtcgcggacacgatggaa
accgccggcgccggcgtgcaggacgtgctcgaccggctggccgccccgcacgagcgggcg
ggagcatga

DBGET integrated database retrieval system