KEGG   Acidiphilium multivorum: ACMV_25990
Entry
ACMV_25990        CDS       T01446                                 
Symbol
trbJ
Name
(GenBank) putative conjugal transfer protein TrbJ
  KO
K20266  type IV secretion system protein TrbJ
Organism
amv  Acidiphilium multivorum
Pathway
amv02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:amv00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ACMV_25990 (trbJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:amv02044]
    ACMV_25990 (trbJ)
Secretion system [BR:amv02044]
 Type IV secretion system
  Trb secretion system protein
   ACMV_25990 (trbJ)
SSDB
Motif
Pfam: DUF948 TolA_bind_tri T4SS Laminin_II DUF724 DUF4377
Other DBs
NCBI-ProteinID: BAJ81946
UniProt: F0J2K2
Position
complement(2859920..2860702)
AA seq 260 aa
MNRPARSRHRQKKIVSMGLIAVLAIAVPIATQAAIPVIDFSNLTQNVLTAARTLDEVNNQ
IAQLQQGISMLENQARNLTALPFSVLSQLQSSMGQINQLMGQAQSLAYSVQQVQQQFRTL
YPNYQSAGFQGNVTQASLLADANARWQASINTFQQTMDVQSQIVAAIPADQADLSSLVTA
SQGAVGALQAIQSSNQLLALQSRQLSATQDLIAADARAQAANAMQNAEVRSAAQAEWQRF
YGNGVGYTFAPVNLFGGSAP
NT seq 783 nt   +upstreamnt  +downstreamnt
atgaatcgccccgcccggtctaggcaccgacagaagaagatcgtcagcatggggttgatc
gccgtgttagcgatcgccgtcccgatcgcgacgcaagccgccatcccggtaatcgatttt
tcgaacctgacccagaacgtgctgacagccgcgcggacgctggacgaggtcaacaaccag
atcgcccagctccagcaaggcatctccatgctggagaatcaggcgcgtaatttgaccgca
ttgccgttctcggttctgtcccagttgcaatcctcgatggggcagatcaaccagctgatg
gggcaggcacaaagccttgcctatagcgtccagcaggtgcagcaacagttccgcaccctc
tatccgaactaccaatcggcaggattccagggcaatgtcacccaggccagcctgctggcc
gatgccaatgcgcgctggcaggcctcgatcaacaccttccaacagacgatggacgtacaa
agccagatcgtcgccgcgatccccgccgatcaggccgatctttcatccttggtcaccgcg
agccagggcgcggtgggtgcgctgcaggcgatccagtccagcaatcagctgctcgccctg
caatcgcgccagctttccgcgacccaggacctgatcgccgcggatgcccgtgcccaggcc
gcgaatgccatgcaaaatgccgaggtccgatcggccgcgcaagccgaatggcaacgcttc
tacggcaacggcgtcggctatacttttgctccggtcaatctgttcggaggatcagcacca
tga

DBGET integrated database retrieval system