KEGG   Acidiphilium multivorum: ACMV_26000
Entry
ACMV_26000        CDS       T01446                                 
Symbol
trbE
Name
(GenBank) conjugal transfer protein TrbE
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
amv  Acidiphilium multivorum
Pathway
amv02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:amv00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ACMV_26000 (trbE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:amv02044]
    ACMV_26000 (trbE)
Enzymes [BR:amv01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     ACMV_26000 (trbE)
Secretion system [BR:amv02044]
 Type IV secretion system
  Trb secretion system protein
   ACMV_26000 (trbE)
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_22 DUF87 AAA_10 ABC_tran AAA_29 AAA_21 AAA_16 AAA_23 FtsK_SpoIIIE T2SSE
Other DBs
NCBI-ProteinID: BAJ81947
UniProt: F0J2K3
Position
complement(2860699..2863419)
AA seq 906 aa
MLDLREYQTRRRELADFLPWAGLVGPGFVLNKDGAFQRTAQFRGPDLDSSTAAELIAVTA
RVNNALKRLGEGWAIFVEAARSAAPGYPASPFPDPVSWLVDEERRHGFEEEGAHFESRYY
LTFCYLAPPERAEQTNRLLYERGHQPDQRQPRRQGQMRGQHENQHQHQHQCQPAARSGGR
WQGDSNNIDWRGILDGFIAETDRVLDLLASLMPDCAWLDDAETLTYLHATISTNGYHPVA
VPEVPFYLDGLLPDCDLTPGVAPMLGRCHLRTITLRGLPDRTWPGLLDELNRVPIEYRWV
ARWLPLEKPEAQKELGRKRRHWWAKRKGIAALLREVIWQQETRLVDTDAENQSLDADIAL
QELGSDAVSFGYFTATVTVWDTDEAAVAEKIRQVGRAMRAQGFVAVEETLNAVEAWLGSL
PGQCYANIRQPLVSSLNLVHLLPLSAVWAGPERNTHLDGPPLLIAHTAGSTPFRLVLHQG
DVGHTLIVGPTGAGKSVLLALIALQFRHYPGARVVIFDKGRSSKATVLGMGGAFHDLALG
GDVSHQHDHAVAFQPLARIDDAAERAWAADWIATLFVQESIELTPEVRGAIWSALGSLAT
APWPERTLSGFAALLQANRLKAALEPYTIAGPFGRLLDAEQESIGTTDVLAFETEDLLGS
KHAARAVLTYLFHRIEAGLDGRPTLIAVDEAWFALDDPVFAPKLREWLKTLRRKNASVLF
STQSLADVTRSPVAPAVIESCLSRIFLPNARAIEPESRDAYARLGLNDRQIETIARAVPK
REYWFQSAAGCRLFELGLGDIALAFCGASRAEDLAAIDRVMATHGPDDFPRAWLRERGLA
WAAELLPPSHAVASDHSNDGAKTRYRLQLDAGVEPPLQHPHLPFDDDVEAQHESNMRTTP
PMEVPS
NT seq 2721 nt   +upstreamnt  +downstreamnt
atgctcgaccttcgggaatatcaaaccagacgcagggaactcgccgactttctgccttgg
gcggggctggtcggtccgggcttcgtgctgaacaaggacggtgccttccagcgtaccgcg
caattccgcggtcctgatctcgattccagcaccgcagccgaattgatcgcggtgaccgcg
cgggtaaataacgcgctcaagcggctcggtgaaggctgggcgatctttgtcgaggccgca
cgatccgccgctccgggctatccggcgagcccattccccgatccggtgtcgtggctggtc
gacgaggaacgccggcacggcttcgaggaggagggggcgcatttcgagagccggtattat
ctgacgttctgctatctcgcgccaccggaacgcgccgagcaaaccaatcgcctgctctac
gagcggggccatcaaccggatcagcgccaaccccgccgccaggggcagatgcgcggccaa
catgaaaaccagcaccaacaccaacaccaatgccaacccgccgcacgaagcggcgggaga
tggcagggcgattcaaacaatatcgactggcgcggcattctggacggcttcatcgccgag
accgaccgggtgctcgacctgctcgcctccctcatgccggattgcgcgtggctcgatgac
gccgagacattgacctatctccatgccacgatctcgaccaatgggtatcatccggtcgcc
gtgccggaggtgccattctatctcgatgggcttttgcccgactgcgatctgacgcccggc
gtcgcgccgatgctcgggcgctgccatctgcgcaccatcacgcttcgtggcttgccagac
cggacctggccgggattgctggacgaactcaaccgcgtgccgatcgaataccgctgggtc
gcgcgctggttgcctctggaaaaacccgaggcgcaaaaggaacttggccgcaagcgccgg
cattggtgggccaagcgcaaaggcatcgccgccctgctgcgcgaggtgatctggcagcag
gagacacggctcgtcgataccgacgcggagaaccagtcgctcgacgccgatattgcgctc
caggaactcggctccgatgccgtcagcttcggctatttcaccgcgacggtgacggtctgg
gataccgacgaagcagcggtcgccgaaaagatccgccaggtcggtcgcgcgatgcgcgcg
cagggtttcgtcgccgtcgaagaaaccctgaacgcggtggaagcctggctcggcagcctg
cccggccagtgctacgccaatatccgccagccgctggtctcctcgctcaacctcgtccac
ctgctgccgctctcggcggtctgggcgggaccggagcgcaacacgcatctcgacggtccg
ccgctgctgatcgcccataccgccggatcgacgccgttccgcttggtgttgcaccagggg
gacgtggggcacacgctgatcgtcggccccaccggcgccggcaagagcgtacttctggcg
ctgatcgcgctgcagttccgccactatcccggcgcgcgcgtggtgatcttcgacaaggga
cgatcctccaaggcgaccgtgcttggcatgggcggggcattccacgatctcgcgcttggc
ggtgatgtctcgcaccagcatgatcacgccgtcgccttccagccgctggcgcggatcgat
gatgccgccgagcgggcctgggcagcggactggatcgccaccctgttcgtccaggagagc
atcgaactcacgcccgaggttcgcggtgccatctggtcagcgctcggttcgctggcgacg
gcgccatggccggagcgcacactatcgggttttgccgcgttgttgcaggccaaccggctc
aaggcggcgctggagccctatacgatcgccggaccgttcggccggctgctcgatgccgag
caggagagcatcggcaccaccgacgtactcgccttcgagaccgaggatctgctcggctcg
aaacacgcggcgcgcgccgtgctgacctatctatttcaccggattgaagccgggctcgac
ggccggccgaccctgatcgcggtcgacgaggcgtggttcgccctggatgatccggtcttt
gcgccaaaactgcgtgaatggctcaagacgctccggcgcaagaatgcctcggtgctgttt
tcgacccagagcctcgccgatgtcacccgctcgccagtcgcccctgcggtgatcgaaagc
tgcctgtcgcgcattttcctgccaaatgcacgcgcgatcgaaccggagagccgggacgcc
tatgcgcgtctcggcctcaatgaccggcagatcgagaccatcgcgcgcgcggtccccaaa
cgcgaatactggttccagtcggccgccggttgccggctattcgaactcggcctcggcgac
atcgcgctggcgttctgcggtgccagccgggcggaagacctcgccgcgatcgaccgggta
atggccacccacggacctgatgattttccgagggcttggctgcgtgagcgcggtctcgct
tgggcggcggagcttctaccaccctcacacgccgtggcttcggatcattcgaatgacggc
gcaaaaactcgttatcgattgcagcttgatgccggcgtcgagcctcccctgcagcacccg
catctccctttcgacgatgatgtcgaagcgcaacacgaatccaacatgcgcaccactccc
ccgatggaggtcccatcatga

DBGET integrated database retrieval system