KEGG   Acidiphilium multivorum: ACMV_27250Help
Entry
ACMV_27250        CDS       T01446                                 

Definition
(GenBank) putative acetyl-CoA acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
amv  Acidiphilium multivorum
Pathway
amv00071  Fatty acid degradation
amv00072  Synthesis and degradation of ketone bodies
amv00280  Valine, leucine and isoleucine degradation
amv00310  Lysine degradation
amv00362  Benzoate degradation
amv00380  Tryptophan metabolism
amv00620  Pyruvate metabolism
amv00630  Glyoxylate and dicarboxylate metabolism
amv00640  Propanoate metabolism
amv00650  Butanoate metabolism
amv00900  Terpenoid backbone biosynthesis
amv01100  Metabolic pathways
amv01110  Biosynthesis of secondary metabolites
amv01120  Microbial metabolism in diverse environments
amv01130  Biosynthesis of antibiotics
amv01200  Carbon metabolism
amv01212  Fatty acid metabolism
amv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:amv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ACMV_27250
   00630 Glyoxylate and dicarboxylate metabolism
    ACMV_27250
   00640 Propanoate metabolism
    ACMV_27250
   00650 Butanoate metabolism
    ACMV_27250
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ACMV_27250
   00072 Synthesis and degradation of ketone bodies
    ACMV_27250
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ACMV_27250
   00310 Lysine degradation
    ACMV_27250
   00380 Tryptophan metabolism
    ACMV_27250
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ACMV_27250
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ACMV_27250
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ACMV_27250
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amv04147]
    ACMV_27250
Enzymes [BR:amv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ACMV_27250
Exosome [BR:amv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ACMV_27250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAJ82072
NITE: ACMV_27250
UniProt: F0J3C6
Position
2998868..3000037
Genome map
AA seq 389 aa AA seqDB search
MTSTAIAGWAHTRFGKSDSPDLEDLLAEAATGAIAHAGIDPNEIDAVFVGNFNNGFTRQD
FPSSLPMQAVPELRFKPATRYENACASGSAAIHAARDFIAAGRGRIALVLGGEKMTACPK
EQVGENLLGACYRREEGDIQAGFAGVFGRIAESYFQRFGDQSDALAAIAAKNHRNGVDNP
YAQMRRDLGFEFCRRESEKNPIVAGPLKRTDCSLVSDGAASIILTDEDTARALPQAVRFR
AAAHVNDFLPLSRRDPTRFEAGERAWAQALAAAGLTLDDLSFVETHDCFTIAELIEYEAM
GLVPRGQGARAVLEGITAPDGRLPVNRSGGLKSKGHPVGATGVSMHVMAAMQLTGTAGDM
QLPRADLAGIYNMGGAGVANYVSILDRLN
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcaccgccatcgccggctgggcgcacacgcgtttcggcaaatccgacagcccc
gatctcgaggatctcctggccgaggccgccaccggcgccatcgcccatgccgggatcgac
ccgaacgagatcgacgccgtcttcgtcggcaatttcaacaacggcttcaccaggcaggat
ttcccctcctcgctgccgatgcaggccgtccccgaactccgcttcaagccggcgacgcgt
tacgagaacgcctgcgcctccggctccgccgccatccatgcggcgcgggatttcatcgcc
gcgggccgcggccgcatcgcgcttgttctcggcggtgagaagatgaccgcctgccccaag
gaacaggtcggcgaaaacctcctcggcgcctgctaccggcgcgaggagggcgacatccag
gccgggttcgccggtgtgttcggccgcatcgccgagagctatttccagcgcttcggcgac
cagtccgacgcgctggccgccatcgccgcgaagaaccaccgcaacggggtcgacaatccc
tacgcgcagatgcgccgcgatctcggcttcgagttctgccgccgtgaatcggaaaaaaat
cctatcgtcgccggcccgttgaagcgcaccgactgctcgctggtcagcgacggcgccgct
tccatcattctgaccgacgaggacaccgcccgcgccttgccgcaggccgtgcgtttccgg
gccgccgcccatgtgaatgatttcctaccgctctcccgccgcgacccgacaaggttcgaa
gccggcgaacgcgcctgggcgcaggcgctcgccgccgccggcctcacgctggacgacctg
tccttcgtcgagacgcatgactgcttcaccatcgccgagctgatcgaatacgaggcgatg
ggcctcgtcccgcgcggccagggcgcgcgcgccgtgctggagggcatcaccgcgccggat
ggaaggctgccggtcaaccgctccggcgggctgaaatccaagggccacccggtcggcgcc
accggtgtctcgatgcatgtgatggcggcgatgcagctcaccggcaccgccggcgacatg
cagctcccccgcgccgacctcgccggcatctacaacatgggcggcgccggggtcgccaac
tacgtctcgatcctcgaccgcctgaactga

DBGET integrated database retrieval system